KEGG   Homo sapiens (human): 22926Help
Entry
22926             CDS       T01001                                 

Gene name
ATF6, ATF6A
Definition
activating transcription factor 6
Orthology
K09054  
cyclic AMP-dependent transcription factor ATF-6 alpha
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    22926 (ATF6)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    22926 (ATF6)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    22926 (ATF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q22-q23
AA seq 670 aa AA seqDB search
MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNL
DFDLDLMPWESDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEE
LDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQ
PKPLLLPAAPKTQTNSSVPAKTIIIQTVPTLMPLAKQQPIISLQPAPTKGQTVLLSQPTV
VQLQAPGVLPSAQPVLAVAGGVTQLPNHVVNVVPAPSANSPVNGKLSVTKPVLQSTMRNV
GSDIAVLRRQQRMIKNRESACQSRKKKKEYMLGLEARLKAALSENEQLKKENGTLKRQLD
EVVSENQRLKVPSPKRRVVCVMIVLAFIILNYGPMSMLEQDSRRMNPSVSPANQRRHLLG
FSAKEAQDTSDGIIQKNSYRYDHSVSNDKALMVLTEEPLLYIPPPPCQPLINTTESLRLN
HELRGWVHRHEVERTKSRRMTNNQQKTRILQGALEQGSNSQLMAVQYTETTSSISRNSGS
ELQVYYASPRSYQDFFEAIRRRGDTFYVVSFRRDHLLLPATTHNKTTRPKMSIVLPAINI
NENVINGQDYEVMMQIDCQVMDTRILHIKSSSVPPYLRDQQRNQTNTFFGSPPAATEATH
VVSTIPESLQ
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgggggagccggctggggttgccggcaccatggagtcaccttttagcccgggactcttt
cacaggctggatgaagattgggattctgctctctttgctgaactcggttatttcacagac
actgatgagctgcaattggaagcagcaaatgagacgtatgaaaacaattttgataatctt
gattttgatttggatttgatgccttgggagtcagacatttgggacatcaacaaccaaatc
tgtacagttaaagatattaaggcagaacctcagccactttctccagcctcctcaagttat
tcagtctcgtctcctcggtcagtggactcttattcttcaactcagcatgttcctgaggag
ttggatttgtcttctagttctcagatgtctcccctttccttatatggtgaaaactctaat
agtctctcttcagcggagccactgaaggaagataagcctgtcactggtcctaggaacaag
actgaaaatggactgactccaaagaaaaaaattcaggtgaattcaaaaccttcaattcag
cccaagcctttattgcttccagcagcacccaagactcaaacaaactccagtgttccagca
aaaaccatcattattcagacagtaccaacgcttatgccattggcaaagcagcaaccaatt
atcagtttacaacctgcacccactaaaggccagacggttttgctgtctcagcctactgtg
gtacaacttcaagcacctggagttctgccctctgctcagccagtccttgctgttgctggg
ggagtcacacagctccctaatcacgtggtgaatgtggtaccagccccttcagcgaatagc
ccagtgaatggaaaactttccgtgactaaacctgtcctacaaagtaccatgagaaatgtc
ggttcagatattgctgtgctaaggagacagcaacgtatgataaaaaatcgagaatccgct
tgtcagtctcgcaagaagaagaaagaatatatgctagggttagaggcgagattaaaggct
gccctctcagaaaacgagcaactgaagaaagaaaatggaacactgaagcggcagctggat
gaagttgtgtcagagaaccagaggcttaaagtccctagtccaaagcgaagagttgtctgt
gtgatgatagtattggcatttataatactgaactatggacctatgagcatgttggaacag
gattccaggagaatgaaccctagtgtgagccctgcaaatcaaaggaggcaccttctagga
ttttctgctaaagaggcacaggacacatcagatggtattatccagaaaaacagctacaga
tatgatcattctgtttcaaatgacaaagccctgatggtgctaactgaagaaccattgctt
tacattcctccacctccttgtcagcccctaattaacacaacagagtctctcaggttaaat
catgaacttcgaggatgggttcatagacatgaagtagaaaggaccaagtcaagaagaatg
acaaataatcaacagaaaacccgtattcttcagggtgctctggaacagggctcaaattct
cagctgatggctgttcaatacacagaaaccactagtagtatcagcaggaactcagggagt
gagctacaagtgtattatgcttcacccagaagttatcaagacttttttgaagccatccgc
agaaggggagacacattttatgttgtgtcatttcgaagggatcacctgctgttaccagct
accacccataacaagaccacaagaccaaaaatgtcaattgtgttaccagcaataaacata
aatgagaatgtgatcaatgggcaggactacgaagtgatgatgcagattgactgtcaggtg
atggacaccaggatcctccatatcaaaagttcgtcagttcctccttacctccgagatcag
cagaggaatcaaaccaacaccttctttggctcccctcccgcagccacagaggcaacccac
gttgtcagcaccatccctgagtcattacaatag

DBGET integrated database retrieval system