KEGG   Homo sapiens (human): 22933Help
Entry
22933             CDS       T01001                                 

Gene name
SIRT2, SIR2, SIR2L, SIR2L2
Definition
(RefSeq) sirtuin 2
  KO
K11412  
NAD-dependent deacetylase sirtuin 2 [EC:3.5.1.-]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     22933 (SIRT2)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     22933 (SIRT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13
AA seq 389 aa AA seqDB search
MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADMDFLRNLFSQTLSLGSQKERLLD
ELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFE
ISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQ
EDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLP
ARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMI
MGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGV
PNPSTSASPKKSPPPAKDEARTTEREKPQ
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcagagccagacccctctcaccctctggagacccaggcagggaaggtgcaggaggct
caggactcagattcagactctgagggaggagccgctggtggagaagcagacatggacttc
ctgcggaacttattctcccagacgctcagcctgggcagccagaaggagcgtctgctggac
gagctgaccttggaaggggtggcccggtacatgcagagcgaacgctgtcgcagagtcatc
tgtttggtgggagctggaatctccacatccgcaggcatccccgactttcgctctccatcc
accggcctctatgacaacctagagaagtaccatcttccctacccagaggccatctttgag
atcagctatttcaagaaacatccggaacccttcttcgccctcgccaaggaactctatcct
gggcagttcaagccaaccatctgtcactacttcatgcgcctgctgaaggacaaggggcta
ctcctgcgctgctacacgcagaacatagataccctggagcgaatagccgggctggaacag
gaggacttggtggaggcgcacggcaccttctacacatcacactgcgtcagcgccagctgc
cggcacgaatacccgctaagctggatgaaagagaagatcttctctgaggtgacgcccaag
tgtgaagactgtcagagcctggtgaagcctgatatcgtcttttttggtgagagcctccca
gcgcgtttcttctcctgtatgcagtcagacttcctgaaggtggacctcctcctggtcatg
ggtacctccttgcaggtgcagccctttgcctccctcatcagcaaggcacccctctccacc
cctcgcctgctcatcaacaaggagaaagctggccagtcggaccctttcctggggatgatt
atgggcctcggaggaggcatggactttgactccaagaaggcctacagggacgtggcctgg
ctgggtgaatgcgaccagggctgcctggcccttgctgagctccttggatggaagaaggag
ctggaggaccttgtccggagggagcacgccagcatagatgcccagtcgggggcgggggtc
cccaaccccagcacttcagcttcccccaagaagtccccgccacctgccaaggacgaggcc
aggacaacagagagggagaaaccccagtga

DBGET integrated database retrieval system