KEGG   Homo sapiens (human): 22934Help
Entry
22934             CDS       T01001                                 

Gene name
RPIA, RPI
Definition
ribose 5-phosphate isomerase A (EC:5.3.1.6)
Orthology
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose phosphate pathway
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Disease
H01135  
Ribose 5-phosphate isomerase (RPI) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    22934 (RPIA)
   01230 Biosynthesis of amino acids
    22934 (RPIA)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    22934 (RPIA)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     22934 (RPIA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p11.2
AA seq 311 aa AA seqDB search
MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSGTRGGAGNTST
SCGDSNSICPAPSTMSKAEEAKKLAGRAAVENHVRNNQVLGIGSGSTIVHAVQRIAERVK
QENLNLVCIPTSFQARQLILQYGLTLSDLDRHPEIDLAIDGADEVDADLNLIKGGGGCLT
QEKIVAGYASRFIVIADFRKDSKNLGDQWHKGIPIEVIPMAYVPVSRAVSQKFGGVVELR
MAVNKAGPVVTDNGNFILDWKFDRVHKWSEVNTAIKMIPGVVDTGLFINMAERVYFGMQD
GSVNMREKPFC
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccccgggcccttcagcaccctctacgggcgggtcttggccccgctgcccggg
agggccgggggcgcggcctccggcggaggagggaacagctgggacctcccgggttcccac
gtgcggctgccggggcgtgcacagtctgggacccgtggcggtgctggcaacacaagcacc
agctgcggggactccaacagcatctgcccggccccctccacgatgtccaaggccgaggag
gccaagaagctggcgggccgcgcggctgtggagaaccacgtgaggaataaccaagtgctg
ggaattggaagtggttctacaattgtccatgctgtgcagcgaatagctgaaagggtgaag
caagagaatctgaacctcgtctgtattcccacttccttccaggcccgccagctcatcctg
cagtatggcttgaccctcagtgatctggatcgacacccagagatcgaccttgccatcgat
ggtgctgatgaagtagatgctgatctcaatctcatcaagggtggcggaggctgcctgacc
caggagaagattgtggctggctatgctagtcgcttcatcgtgatcgctgatttcaggaaa
gattcgaagaatctcggggatcagtggcacaagggaatccccatcgaggtcatcccaatg
gcctatgtcccagtgagccgagctgtgagccagaagtttgggggcgtggttgaacttcga
atggctgtcaacaaggctggtcctgtggtgacagataatgggaattttatcttggactgg
aagtttgaccgggtacacaaatggagtgaagtgaatacagctatcaaaatgatcccaggt
gtggtggacacaggcctattcatcaacatggctgagagagtctactttgggatgcaggat
ggctcagtgaacatgagggagaagcctttctgttga

DBGET integrated database retrieval system