KEGG   Homo sapiens (human): 22934Help
Entry
22934             CDS       T01001                                 

Gene name
RPIA, RPI, RPIAD
Definition
(RefSeq) ribose 5-phosphate isomerase A (EC:5.3.1.6)
  KO
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Disease
H01135  
Ribose 5-phosphate isomerase (RPI) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    22934 (RPIA)
   01230 Biosynthesis of amino acids
    22934 (RPIA)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    22934 (RPIA)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     22934 (RPIA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p11.2
AA seq 311 aa AA seqDB search
MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSGTRGGAGNTST
SCGDSNSICPAPSTMSKAEEAKKLAGRAAVENHVRNNQVLGIGSGSTIVHAVQRIAERVK
QENLNLVCIPTSFQARQLILQYGLTLSDLDRHPEIDLAIDGADEVDADLNLIKGGGGCLT
QEKIVAGYASRFIVIADFRKDSKNLGDQWHKGIPIEVIPMAYVPVSRAVSQKFGGVVELR
MAVNKAGPVVTDNGNFILDWKFDRVHKWSEVNTAIKMIPGVVDTGLFINMAERVYFGMQD
GSVNMREKPFC
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccccgggcccttcagcaccctctacgggcgggtcttggccccgctgcccggg
agggccgggggcgcggcctccggcggaggagggaacagctgggacctcccgggttcccac
gtgcggctgccggggcgtgcacagtctgggacccgtggcggtgctggcaacacaagcacc
agctgcggggactccaacagcatctgcccggccccctccacgatgtccaaggccgaggag
gccaagaagctggcgggccgcgcggctgtggagaaccacgtgaggaataaccaagtgctg
ggaattggaagtggttctacaattgtccatgctgtgcagcgaatagctgaaagggtgaag
caagagaatctgaacctcgtctgtattcccacttccttccaggcccgccagctcatcctg
cagtatggcttgaccctcagtgatctggatcgacacccagagatcgaccttgccatcgat
ggtgctgatgaagtagatgctgatctcaatctcatcaagggtggcggaggctgcctgacc
caggagaagattgtggctggctatgctagtcgcttcatcgtgatcgctgatttcaggaaa
gattcgaagaatctcggggatcagtggcacaagggaatccccatcgaggtcatcccaatg
gcctatgtcccagtgagccgagctgtgagccagaagtttgggggcgtggttgaacttcga
atggctgtcaacaaggctggtcctgtggtgacagataatgggaattttatcttggactgg
aagtttgaccgggtacacaaatggagtgaagtgaatacagctatcaaaatgatcccaggt
gtggtggacacaggcctattcatcaacatggctgagagagtctactttgggatgcaggat
ggctcagtgaacatgagggagaagcctttctgttga

DBGET integrated database retrieval system