KEGG   Homo sapiens (human): 22938Help
Entry
22938             CDS       T01001                                 

Gene name
SNW1, Bx42, NCOA-62, PRPF45, Prp45, SKIIP, SKIP
Definition
SNW domain containing 1
Orthology
K06063  
SNW domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Notch signaling pathway
Epstein-Barr virus infection
Viral carcinogenesis
Module
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    22938 (SNW1)
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    22938 (SNW1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    22938 (SNW1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    22938 (SNW1)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19-related factors
    22938 (SNW1)
 Complex C
    22938 (SNW1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q24.3
AA seq 536 aa AA seqDB search
MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGD
GGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLV
PKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYT
PSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVK
EQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKARE
AVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRR
KERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDS
GFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSG
SDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcaccagctttttacctgcacctactcagctatctcaggaccagcttgaggct
gaagaaaaggcaagatcccagagatcacggcagacctcactggtctcctcccgaagagaa
cctcccccgtacggataccggaaaggctggatacctcggttattagaggattttggagat
ggaggtgcttttccagagatccatgtggcccagtatccactggatatgggacgaaagaaa
aaaatgtcgaatgcgctggccattcaggtggattctgaaggaaaaattaaatatgatgca
attgctcgacaaggacagtcaaaagacaaggtcatttatagcaaatacactgacctggtt
ccaaaggaggttatgaatgcagatgatccagacctgcaaaggcccgatgaagaagctatt
aaagagataacagaaaagacaagagtagccttagaaaaatctgtatcacagaaggtcgcc
gcagccatgccagttcgagcagctgacaaattggctcctgctcagtatatccgatacaca
ccatctcagcaaggagtggcattcaactctggagctaaacagagggttattcggatggta
gaaatgcagaaagatccaatggagcctccaaggttcaagattaataagaaaattccccgg
ggaccaccttctcctcctgcgcctgtcatgcattctcctagccgaaagatgactgtaaag
gaacaacaagagtggaagattcctccttgtatttctaactggaaaaatgcaaagggttat
acaattccattagacaaacgtctggctgctgatggaagaggactacagacagtacacata
aatgaaaatttcgccaaattggcagaagccctctacattgctgatcggaaggctcgtgaa
gctgtggaaatgcgtgcccaagtagagagaaaaatggctcagaaagaaaaggaaaaacat
gaagagaaacttagagaaatggcccagaaagccagggagagaagagctgggatcaaaact
catgtggaaaaagaggatggggaggcacgtgagagggatgaaatccggcatgacaggcga
aaagagagacagcatgaccggaatctttccagggcagctcctgataagaggtcgaaactt
cagagaaatgaaaatcgggatatcagtgaagttattgctctcggtgttcctaatcctcgg
acttccaatgaagttcagtatgaccaaaggctcttcaaccaatccaagggtatggacagt
ggatttgcaggtggagaagatgaaatttataatgtttatgatcaagcctggagaggtggt
aaagatatggcccagagtatttataggcccagtaaaaatctggacaaggacatgtatggt
gatgacctagaagccagaataaagaccaacagatttgttcccgacaaggagttttctggt
tcagaccgtagacagagaggccgagaaggaccagtgcagtttgaggaagatccttttggt
ttggacaagtttttggaagaagccaaacagcatggtggctctaaaagaccctcagatagc
agccgccccaaggaacacgagcatgaaggcaagaagaggaggaaggaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system