KEGG   Homo sapiens (human): 22941Help
Entry
22941             CDS       T01001                                 

Gene name
SHANK2, AUTS17, CORTBP1, CTTNBP1, ProSAP1, SHANK, SPANK-3
Definition
(RefSeq) SH3 and multiple ankyrin repeat domains 2
  KO
K15009  
SH3 and multiple ankyrin repeat domains protein
Organism
hsa  Homo sapiens (human)
Pathway
Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    22941 (SHANK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9UPX8(Tbio)
UniProt: 
Position
11q13.3-q13.4
AA seq 1261 aa AA seqDB search
MMMNVPGGGAAAVMMTGYNNGRCPRNSLYSDCIIEEKTVVLQKKDNEGFGFVLRGAKADT
PIEEFTPTPAFPALQYLESVDEGGVAWQAGLRTGDFLIEVNNENVVKVGHRQVVNMIRQG
GNHLVLKVVTVTRNLDPDDTARKKAPPPPKRAPTTALTLRSKSMTSELEELVDKASVRKK
KDKPEEIVPASKPSRAAENMAVEPRVATIKQRPSSRCFPAGSDMNSVYERQGIAVMTPTV
PGSPKAPFLGIPRGTMRRQKSIDSRIFLSGITEEERQFLAPPMLKFTRSLSMPDTSEDIP
PPPQSVPPSPPPPSPTTYNCPKSPTPRVYGTIKPAFNQNSAAKVSPATRSDTVATMMREK
GMYFRRELDRYSLDSEDLYSRNAGPQANFRNKRGQMPENPYSEVGKIASKAVYVPAKPAR
RKGMLVKQSNVEDSPEKTCSIPIPTIIVKEPSTSSSGKSSQGSSMEIDPQAPEPPSQLRP
DESLTVSSPFAAAIAGAVRDREKRLEARRNSPAFLSTDLGDEDVGLGPPAPRTRPSMFPE
EGDFADEDSAEQLSSPMPSATPREPENHFVGGAEASAPGEAGRPLNSTSKAQGPESSPAV
PSASSGTAGPGNYVHPLTGRLLDPSSPLALALSARDRAMKESQQGPKGEAPKADLNKPLY
IDTKMRPSLDAGFPTVTRQNTRGPLRRQETENKYETDLGRDRKGDDKKNMLIDIMDTSQQ
KSAGLLMVHTVDATKLDNALQEEDEKAEVEMKPDSSPSEVPEGVSETEGALQISAAPEPT
TVPGRTIVAVGSMEEAVILPFRIPPPPLASVDLDEDFIFTEPLPPPLEFANSFDIPDDRA
ASVPALSDLVKQKKSDTPQSPSLNSSQPTNSADSKKPASLSNCLPASFLPPPESFDAVAD
SGIEEVDSRSSSDHHLETTSTISTVSSISTLSSEGGENVDTCTVYADGQAFMVDKPPVPP
KPKMKPIIHKSNALYQDALVEEDVDSFVIPPPAPPPPPGSAQPGMAKVLQPRTSKLWGDV
TEIKSPILSGPKANVISELNSILQQMNREKLAKPGEGLDSPMGAKSASLAPRSPEIMSTI
SGTRSTTVTFTVRPGTSQPITLQSRPPDYESRTSGTRRAPSPVVSPTEMNKETLPAPLSA
ATASPSPALSDVFSLPSQPPSGDLFGLNPAGRSRSPSPSILQQPISNKPFTTKPVHLWTK
PDVADWLESLNLGEHKEAFMDNEIDGSHLPNLQKEDLIDLGVTRVGHRMNIERALKQLLD
R
NT seq 3786 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgaacgtccccggcggaggagcggccgcggtgatgatgacgggctacaataat
ggtcgctgtccccggaattctctctacagtgactgcattattgaggagaagacggtggtc
ctgcagaaaaaagacaatgagggctttggattcgtgcttcgaggggccaaagctgacaca
cccattgaagaattcacaccaacaccggctttcccagccctacagtacctggagtccgtg
gatgaaggtggggtggcgtggcaagccggactaaggaccggggacttcttgattgaggtt
aacaatgagaatgttgtcaaagtcggccacaggcaggtggtgaacatgatccggcaggga
gggaatcacctggtccttaaggtggtcacggtgaccaggaatctggaccccgacgacacc
gccaggaagaaagctcccccgcctccaaagcgggcaccgaccacagccctcaccctgcgc
tccaagtccatgacctcggagctggaggagctcgtggataaagcctcggtccggaagaag
aaggataaacccgaggagatagtcccggcctccaagccctcccgcgctgctgagaacatg
gctgtggaaccgagggtggcgaccatcaagcagcggcccagcagccggtgcttcccggcg
ggctcagacatgaactctgtgtacgaacgccaaggaatcgccgtgatgacgcccactgtt
cctgggagcccaaaagccccgtttctgggcatccctcgaggtacgatgcgaaggcagaaa
tcaatagacagcagaatctttctatcaggaataacagaggaagagcggcagtttctggct
cctccaatgctgaagttcaccagaagcctgtccatgccggacacctctgaggacatcccc
cctccaccgcagtctgtgcccccgtccccaccaccaccttccccaaccacttacaactgc
cccaagtccccaactccaagagtctacgggacgattaagcctgcgttcaatcagaattct
gccgccaaggtgtcccccgccaccaggtccgacaccgtggccaccatgatgagggagaag
gggatgtacttcaggagagagctggaccgctactccttggactctgaagacctctacagt
cggaatgccggcccgcaagccaacttccgcaacaagagaggccagatgccagaaaaccca
tactcagaggtggggaagatcgccagcaaagccgtctacgtccccgccaagcccgccagg
cggaaggggatgctggtgaagcagtccaacgtggaggacagccccgagaagacgtgctcc
atccctatcccgaccatcatcgtgaaggagccgtccaccagcagcagcggcaagagcagc
cagggcagcagcatggagatcgacccccaggccccggagccaccgagccagctgcggcct
gacgaaagcctgaccgtcagcagcccctttgccgccgccatcgccggagccgtccgcgac
cgtgagaagcggctggaagccaggaggaactccccggccttcctctccacagacctgggg
gatgaggatgtgggcctggggccacccgcccccaggacgcggccctccatgttccccgag
gagggggattttgctgacgaggacagcgctgagcagctgtcatcccccatgccgagtgcc
acgcccagggagcccgaaaaccatttcgtgggtggcgccgaggccagtgctccgggtgag
gctgggaggccgctgaattccacgtccaaagcccaggggcccgagagcagcccagcagtg
ccctccgcgagcagcggcacagccggccccgggaattatgtccacccactcacagggcgg
ctgcttgatcccagctccccgctggccctggcactctccgcaagggaccgagccatgaag
gagtctcaacagggacccaaaggggaggcccccaaggccgacctcaacaaacctctttac
attgataccaaaatgcggcccagcctggatgccggcttccctacggtcaccaggcagaac
acccggggacccctgaggcggcaggagacggagaacaagtacgagaccgacctgggccga
gaccggaaaggcgatgacaagaagaacatgctgatcgacatcatggacacgtcccagcag
aagtcggctggcctgctgatggtgcacaccgtggacgccactaagctggacaacgccctg
caggaagaggacgagaaggcagaggtggagatgaagccagacagctcgccgtccgaggtg
ccagaaggtgtttccgaaaccgaaggtgctttacagatctccgctgcccccgagcccacc
accgtgcccggcagaaccatcgtcgcggtgggctccatggaagaggcggtgattttgcca
ttccgcatccctcctccccctctggcatccgtggacttggatgaggattttatttttaca
gagccattgcctcctcccctggaatttgcaaatagttttgatatccccgatgaccgggca
gcttctgtcccggctctctcagacttagtgaagcagaagaaaagcgacacccctcagtcc
ccttcgttgaactccagccaaccaaccaactctgcagacagcaagaagccagccagtctt
tcaaactgtctgcctgcctcattcctgccaccccctgaaagctttgacgccgtcgccgac
tctgggatcgaggaggtggacagccggagtagcagcgaccaccacctcgagacgaccagc
actatctccaccgtgtctagcatctccaccctgtcttccgaaggtggagagaatgtggac
acctgcacagtctatgcagatgggcaagcatttatggttgacaaacccccagtacctcct
aagccaaaaatgaagcccatcattcacaaaagcaatgcactttatcaagacgcgctcgtg
gaagaagatgtagatagctttgttatccccccgcccgctcccccgcccccgccgggcagt
gcccagcctgggatggccaaggttctccagccaaggacctccaagttgtggggcgacgtc
acagagatcaaaagcccgattctctcaggcccaaaggcaaacgttattagtgaattgaac
tctatcctacagcaaatgaaccgagagaaattggcaaagccgggggaaggactggattca
ccaatgggagccaagtccgccagcctcgctccaagaagcccggagatcatgagcaccatc
tcaggtacacggagcacgacggtcaccttcactgttcgccccggcacctcccagcccatc
accctgcagagccggccccccgactatgaaagcaggacctcaggaacaagacgtgcccca
agccctgtggtctcgccaacagagatgaacaaagagaccctgcccgcccccctgtctgct
gccaccgcctctccttctcccgctctctcagatgtctttagccttccaagccagccccct
tctggggatctatttggcttgaacccagcgggacgcagtaggtcgccatccccctcgata
ctgcaacagccaatctcaaataagccttttacaactaaacctgtccacctgtggactaaa
ccagatgtggccgattggctggaaagtctaaacttgggtgaacataaagaggccttcatg
gacaatgagatcgatggcagtcacttaccaaacctgcagaaggaggacctcatcgatctt
ggggtaactcgagtcgggcacagaatgaacatagaaagggctttgaaacagctgctggac
agataa

DBGET integrated database retrieval system