KEGG   Homo sapiens (human): 22943Help
Entry
22943             CDS       T01001                                 

Gene name
DKK1, DKK-1, SK
Definition
dickkopf WNT signaling pathway inhibitor 1
Orthology
K02165  
dickkopf
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:hsa04310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q11.2
AA seq 266 aa AA seqDB search
MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAV
SAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKR
CMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYH
TKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCG
EGLSCRIQKDHHQASNSSRLHTCQRH
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgatggctctgggcgcagcgggagctacccgggtctttgtcgcgatggtagcggcggct
ctcggcggccaccctctgctgggagtgagcgccaccttgaactcggttctcaattccaac
gctatcaagaacctgcccccaccgctgggcggcgctgcggggcacccaggctctgcagtc
agcgccgcgccgggaatcctgtacccgggcgggaataagtaccagaccattgacaactac
cagccgtacccgtgcgcagaggacgaggagtgcggcactgatgagtactgcgctagtccc
acccgcggaggggacgcaggcgtgcaaatctgtctcgcctgcaggaagcgccgaaaacgc
tgcatgcgtcacgctatgtgctgccccgggaattactgcaaaaatggaatatgtgtgtct
tctgatcaaaatcatttccgaggagaaattgaggaaaccatcactgaaagctttggtaat
gatcatagcaccttggatgggtattccagaagaaccaccttgtcttcaaaaatgtatcac
accaaaggacaagaaggttctgtttgtctccggtcatcagactgtgcctcaggattgtgt
tgtgctagacacttctggtccaagatctgtaaacctgtcctgaaagaaggtcaagtgtgt
accaagcataggagaaaaggctctcatggactagaaatattccagcgttgttactgtgga
gaaggtctgtcttgccggatacagaaagatcaccatcaagccagtaattcttctaggctt
cacacttgtcagagacactaa

DBGET integrated database retrieval system