KEGG   Homo sapiens (human): 22953Help
Entry
22953             CDS       T01001                                 

Gene name
P2RX2, DFNA41, P2X2
Definition
purinergic receptor P2X, ligand-gated ion channel, 2
Orthology
K05216  
P2X purinoceptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Drug target
Suramin sodium: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    22953 (P2RX2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    22953 (P2RX2)
Ion channels [BR:hsa04040]
 Epithelial and related channels
  ATP-gated cation channel (P2X)
   22953 (P2RX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.33
AA seq 370 aa AA seqDB search
MAAAQPKYPAGATARRLARGCWSALWDYETPKVIVVRNRRLGVLYRAVQLLILLYFVWYV
FIVQKSYQESETGPESSIITKVKGITTSEHKVWDVEEYVKPPESIRVHNATCLSDADCVA
GELDMLGNGALQDLRGVRLVPGGRWGLCQPISGYDGPKFHHPHQEQHPLPQIPLLQGQHR
RPHRRVPEALHVPRGLRPLLPHLQAGLYRGEGWGELHRARTQGRGGVIGVIINWDCDLDL
PASECNPKYSFRRLDPKHVPASSGYNFRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAG
KFSLIPTIINLATALTSVGVGSFLCDWILLTFMNKNKVYSHKKFDKMVDTPASEPAQAST
PTDPKGLAQL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcccagcccaagtaccccgccggggcgaccgcccggcgcctggcccggggc
tgctggtccgccctctgggactacgagacgcccaaggtgatcgtggtgaggaaccggcgc
ctgggggtcctgtaccgcgccgtgcagctgctcatcctgctctacttcgtgtggtacgta
ttcatcgtgcagaaaagctaccaggagagcgagacgggccccgagagctccatcatcacc
aaggtcaaggggatcaccacgtccgagcacaaagtgtgggacgtggaggagtacgtgaag
ccccccgagagcataagggtccacaacgccacctgcctctccgacgccgactgcgtggct
ggggagctggacatgctgggaaacggggccctccaagacctgcgaggtgttcggctggtg
cccggtggaagatggggcctctgtcagccaatttctgggtacgatggccccaaatttcac
catcctcatcaagaacagcatccactaccccaaattccacttctccaagggcaacatcgc
cgaccgcacagacgggtacctgaagcgctgcacgttccacgaggcctccgacctctactg
ccccatcttcaagctgggctttatcgtggagaaggctggggagagcttcacagagctcgc
acacaaggcaggggtggtgtcatcggggtcattatcaactgggactgtgacctggacctg
cctgcatcggagtgcaaccccaagtactccttccggaggcttgaccccaagcacgtgcct
gcctcgtcaggctacaacttcaggtttgccaaatactacaagatcaatggcaccaccacc
cgcacgctcatcaaggcctacgggatccgcattgacgtcattgtgcatggacaggccggg
aagttcagcctgattcccaccattattaatctggccacagctctgacttccgtcggggtg
ggctccttcctgtgcgactggatcttgctaacattcatgaacaaaaacaaggtctacagc
cataagaaatttgacaagatggtggacactcctgcctccgagcctgcccaagcctccaca
cccacagaccccaaaggtttggctcaactctga

DBGET integrated database retrieval system