KEGG   Homo sapiens (human): 22954Help
Entry
22954             CDS       T01001                                 

Gene name
TRIM32, BBS11, HT2A, LGMD2H, TATIP
Definition
(RefSeq) tripartite motif containing 32
  KO
K10607  
tripartite motif-containing protein 32 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Disease
H00418  
Bardet-Biedl syndrome (BBS)
H00593  
Limb-girdle muscular dystrophy (LGMD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    22954 (TRIM32)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     22954 (TRIM32)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    22954 (TRIM32)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q33.1
AA seq 653 aa AA seqDB search
MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVR
CPFCSKITRITSLTQLTDNLTVLKIIDTAGLSEAVGLLMCRSCGRRLPRQFCRSCGLVLC
EPCREADHQPPGHCTLPVKEAAEERRRDFGEKLTRLRELMGELQRRKAALEGVSKDLQAR
YKAVLQEYGHEERRVQDELARSRKFFTGSLAEVEKSNSQVVEEQSYLLNIAEVQAVSRCD
YFLAKIKQADVALLEETADEEEPELTASLPRELTLQDVELLKVGHVGPLQIGQAVKKPRT
VNVEDSWAMEATASAASTSVTFREMDMSPEEVVASPRASPAKQRGPEAASNIQQCLFLKK
MGAKGSTPGMFNLPVSLYVTSQGEVLVADRGNYRIQVFTRKGFLKEIRRSPSGIDSFVLS
FLGADLPNLTPLSVAMNCQGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPS
GQFVVTDVEGGKLWCFTVDRGSGVVKYSCLCSAVRPKFVTCDAEGTVYFTQGLGLNLENR
QNEHHLEGGFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEIL
HFPKGGGYSVLIREGLTCPVGIALTPKGQLLVLDCWDHCIKIYSYHLRRYSTP
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagcagcagcttctcacctgaacctggatgccctccgggaagtgctagaatgc
cccatctgcatggagtccttcacagaagagcagctgcgtcccaagcttctgcactgtggc
cataccatctgccgccagtgcctggagaagctattggccagtagcatcaatggtgtccgc
tgtcccttttgcagcaagattacccgcataaccagcttgacccagctgacagacaatctg
acagtgctaaagatcattgatacagctgggctcagcgaggctgtggggctgctcatgtgt
cggtcctgtgggcggcgtctgccccggcaattctgccggagctgtggtttggtgttatgt
gagccctgccgggaggcagaccatcagcctcctggccactgtacactccctgtcaaagaa
gcagctgaggagcggcgtcgggactttggagagaagttaactcgtctgcgggaacttatg
ggggagctgcagcggcggaaggcagccttggaaggtgtctccaaggaccttcaggcaagg
tataaagcagttctccaggagtatgggcatgaggagcgcagggtccaggatgagctggct
cgctctcggaagttcttcacaggctctttggctgaagttgagaagtccaatagtcaagtg
gtagaggagcagagttacctgcttaacattgcagaggtgcaggctgtgtctcgctgtgac
tacttcctggccaagatcaagcaggcagatgtagcactactggaggagacagctgatgag
gaggagccagagctcactgccagcttgcctcgggagctcaccctgcaagatgtggagctc
cttaaggtaggtcatgttggccccctccaaattggacaagctgttaagaagccccggaca
gttaacgtggaagattcctgggccatggaggccacagcgtctgctgcctctacctctgtt
acttttagagagatggacatgagcccggaggaagtggttgccagccctagggcctcacct
gctaaacagcggggtcctgaggcagcctccaatatccagcagtgcctctttctcaagaag
atgggggccaaaggcagcactccaggaatgttcaatcttccagtcagtctctacgtgacc
agtcaaggtgaagtactagtcgctgaccgtggtaactatcgtatacaagtctttacccgc
aaaggctttttgaaggaaatccgccgcagccccagtggcattgatagctttgtgctaagc
ttccttggggcagatctacccaacctcactcctctctcagtggcaatgaactgccagggg
ctgattggtgtgactgacagctatgataactccctcaaggtatataccttggatggccac
tgcgtggcctgtcacaggagccagctgagcaaaccatggggtatcacagccttgccatct
ggccagtttgtagtaaccgatgtggaaggtggaaagctttggtgtttcacagttgatcga
ggatcaggggtggtcaaatacagctgcctatgtagtgctgtgcggcccaaatttgtcacc
tgtgatgctgagggcaccgtctacttcacccagggcttaggcctcaatctggagaatcgg
cagaatgagcaccacctggagggtggcttttccattggctctgtaggccctgatgggcag
ctgggtcgccagattagccacttcttctcggagaatgaggatttccgctgcattgctggc
atgtgtgtggatgctcgtggtgatctcatcgtggctgacagtagtcgcaaggaaattctc
cattttcctaagggtgggggctatagtgtccttattcgagagggacttacctgtccggtg
ggcatagccctaactcctaaggggcagctgctggtcttggactgttgggatcattgcatc
aagatctacagctaccatctgagaagatattccaccccatag

DBGET integrated database retrieval system