KEGG   Homo sapiens (human): 22978Help
Entry
22978             CDS       T01001                                 

Gene name
NT5C2, GMP, NT5B, PNT5, SPG45, SPG65, cN-II
Definition
5'-nucleotidase, cytosolic II (EC:3.1.3.5)
Orthology
K01081  
5'-nucleotidase [EC:3.1.3.5]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    22978 (NT5C2)
   00240 Pyrimidine metabolism
    22978 (NT5C2)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    22978 (NT5C2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     22978 (NT5C2)
Cellular antigens [BR:hsa04090]
 Proteins
  22978 (NT5C2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q24.32
AA seq 561 aa AA seqDB search
MSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVY
KSPEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLV
CAHGFNFIRGPETREQYPNKFIQRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTS
CETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVENLEKYVVKDGKLPLLLSRMK
EVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGT
VLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKS
KKRQGWRTFLVIPELAQELHVWTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQ
RRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAA
HVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNLFPLA
PQEITHCHDEDDDEEEEEEEE
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacctcctggagtgatcggttacagaatgcagcagatatgcctgctaacatggat
aagcatgccctgaaaaagtatcgtcgagaagcctatcatcgggtgtttgtgaaccgaagt
ttagcaatggaaaagataaagtgttttggttttgatatggattatacccttgctgtgtac
aagtccccagagtatgagtcccttggttttgagcttactgtggagagattagtttctatt
ggctatccccaggagttgctcagctttgcttatgattctacattccctaccaggggactt
gtctttgacacactgtatggaaatcttttgaaagtcgatgcctatggaaacctcttggtc
tgtgcacatggatttaactttataaggggaccagaaactagagaacagtatccaaataaa
tttatccagcgagatgatactgaaagattttacattctgaacacactattcaacctacca
gagacctacctgttggcctgcctagtagatttttttactaattgtcccagatataccagt
tgtgaaacaggatttaaagatggggacctcttcatgtcctaccggagtatgttccaggat
gtaagagatgctgttgactgggttcattacaagggctcccttaaggaaaagacagttgaa
aatcttgagaagtatgtagtcaaagatggaaaactgcctttgcttctgagccggatgaag
gaagtagggaaagtatttcttgctaccaacagtgactataaatatacagataaaattatg
acttacctgtttgacttcccacatggccccaagcctgggagctcccatcgaccatggcag
tcctactttgacttgatcttggtggatgcacggaaaccactcttttttggagaaggcaca
gtactgcgtcaggtggatactaaaactggcaagctgaaaattggtacctacacagggccc
ctacagcatggtatcgtctactcaggaggttcttctgatacgatctgtgacctgttggga
gccaagggaaaagacattttgtatattggagatcacatttttggggacattttaaaatca
aagaaacggcaagggtggcgaacttttttggtgattcctgaactcgcacaggagctacat
gtctggactgacaagagttcacttttcgaagaacttcagagcttggatattttcttggct
gaactctacaagcatcttgacagcagtagcaatgagcgtccagacatcagttccatccag
agacgtattaagaaagtaactcatgacatggacatgtgctatgggatgatgggaagcctg
tttcgcagtggctcccggcagaccctttttgccagtcaagtgatgcgttatgctgacctc
tatgcagcatctttcatcaacctgctgtattaccctttcagctacctcttcagggctgcc
catgtcttgatgcctcatgaatcaacggtggagcacacacacgtagatatcaatgagatg
gagtctcctcttgccacccggaaccgcacatcagtggatttcaaagacactgactacaag
cggcaccagctgacacggtcaattagtgagattaaacctcccaacctcttcccactggcc
ccccaggaaattacacactgccatgacgaagatgatgatgaagaggaggaggaggaggaa
gaataa

DBGET integrated database retrieval system