KEGG   Homo sapiens (human): 22985Help
Entry
22985             CDS       T01001                                 

Gene name
ACIN1, ACINUS, ACN, fSAP152
Definition
apoptotic chromatin condensation inducer 1
Orthology
K12875  
apoptotic chromatin condensation inducer in the nucleus
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
mRNA surveillance pathway
Spliceosome
Module
Exon junction complex (EJC)
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:hsa03040]
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:hsa03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q11.2
AA seq 1328 aa AA seqDB search
MWRRKHPRTSGGTRGVLSGNRGVEYGSGRGHLGTFEGRWRKLPKMPEAVGTDPSTSRKMA
ELEEVTLDGKPLQALRVTDLKAALEQRGLAKSGQKSALVKRLKGALMLENLQKHSTPHAA
FQPNSQIGEEMSQNSFIKQYLEKQQELLRQRLEREAREAAELEEASAESEDEMIHPEGVA
SLLPPDFQSSLERPELELSRHSPRKSSSISEEKGDSDDEKPRKGERRSSRVRQARAAKLS
EGSQPAEEEEDQETPSRNLRVRADRNLKTEEEEEEEEEEEEDDEEEEGDDEGQKSREAPI
LKEFKEEGEEIPRVKPEEMMDERPKTRSQEQEVLERGGRFTRSQEEARKSHLARQQQEKE
MKTTSPLEEEEREIKSSQGLKEKSKSPSPPRLTEDRKKASLVALPEQTASEEETPPPLLT
KEASSPPPHPQLHSEEEIEPMEGPAPPVLIQLSPPNTDADTRELLVSQHTVQLVGGLSPL
SSPSDTKAESPAEKVPEESVLPLVQKSTLADYSAQKDLEPESDRSAQPLPLKIEELALAK
GITEECLKQPSLEQKEGRRASHTLLPSHRLKQSADSSSSRSSSSSSSSSRSRSRSPDSSG
SRSHSPLRSKQRDVAQARTHANPRGRPKMGSRSTSESRSRSRSRSRSASSNSRKSLSPGV
SRDSSTSYTETKDPSSGQEVATPPVPQLQVCEPKERTSTSSSSVQARRLSQPESAEKHVT
QRLQPERGSPKKCEAEEAEPPAATQPQTSETQTSHLPESERIHHTVEEKEEVTMDTSENR
PENDVPEPPMPIADQVSNDDRPEGSVEDEEKKESSLPKSFKRKISVVSTKGVPAGNSDTE
GGQPGRKRRWGASTATTQKKPSISITTESLKEAVVDLHADDSRISEDETERNGDDGTHDK
GLKICRTVTQVVPAEGQENGQREEEEEEKEPEAEPPVPPQVSVEVALPPPAEHEVKKVTL
GDTLTRRSISQQKSGVSITIDDPVRTAQVPSPPRGKISNIVHISNLVRPFTLGQLKELLG
RTGTLVEEAFWIDKIKSHCFVTYSTVEEAVATRTALHGVKWPQSNPKFLCADYAEQDELD
YHRGLLVDRPSETKTEEQGIPRPLHPPPPPPVQPPQHPRAEQREQERAVREQWAEREREM
ERRERTRSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKEKAQEEPPAKLLDD
LFRKTKAAPCIYWLPLTDSQIVQKEAERAERAKEREKRRKEQEEEEQKEREKEAERERNR
QLEREKRREHSRERDRERERERERDRGDRDRDRERDRERGRERDRRDTKRHSRSRSRSTP
VRDRGGRR
NT seq 3987 nt NT seq  +upstreamnt  +downstreamnt
atgtggagacggaaacatccgaggacatccggaggaacccggggagttctgagtggtaat
cgaggggtagagtatggcagtgggcggggtcatctcggtacgttcgaagggcgttggcgg
aaattaccgaagatgcccgaagccgtcgggacggacccgagtacctcacgcaagatggcg
gagctggaggaggtgactctggacgggaagcctcttcaggcgctgcgggtgaccgacctg
aaggccgcactggagcagcgaggcctagccaagagcgggcagaagagtgccctggtcaag
cggctcaaaggggctctaatgctagaaaatttacagaaacactcaacaccccatgctgca
ttccagccaaattcccagattggtgaggaaatgagccagaacagtttcataaaacagtat
ctggaaaagcagcaggagctacttaggcagcgtctggaacgtgaagctcgagaagctgca
gaacttgaagaagcttcagctgagtcggaggacgagatgatccatcctgagggagtggct
tccctgctgcctcctgactttcagagcagcctggagagaccagagctggagctcagcaga
cattcgcccagaaaaagctcctcaatttctgaagagaaaggtgactctgatgatgagaaa
ccaaggaaaggagaaagacgatcatctagggtcagacaggcaagagcagctaaactgtct
gagggcagccaacctgctgaggaggaagaggatcaagaaacaccttccagaaacctaagg
gtcagagcagatcgaaatttgaaaacagaggaggaagaagaggaggaggaggaggaggaa
gaagatgatgaagaagaggaaggtgatgatgagggacaaaaatctagggaggcaccaatc
ctgaaagagtttaaggaagaaggggaagagatacctagagtaaaaccagaggagatgatg
gatgagagacccaaaacaagatcccaggaacaggaggtgttagagagaggagggagattt
acaagatcccaggaagaggctagaaaaagtcatctggccagacagcagcaggagaaggaa
atgaaaacaacatctccccttgaggaggaagaaagagaaataaaatcttcacaaggctta
aaggaaaaatcgaagtctccttcccctcctcgactgactgaagatcgaaagaaggcctca
cttgtagcgctgccagagcaaactgccagcgaggaggagactcctccacctttactaaca
aaggaagcatcttctccaccacctcatccacagctccatagcgaagaagaaatagagccc
atggaaggcccagccccccctgtcctcattcagttatctcctcctaatacagatgctgac
accagggagctattagtatctcagcatactgtccagttggtaggaggcctgtctcctttg
tcaagtccttcagacaccaaagcagaatctccagcagagaaagtgccagaggagagtgtc
ctgcctctggttcagaaaagcacactggctgactactcagcccagaaggatcttgaacct
gagtcagacagatctgctcagcccctccctctaaaaattgaggaattagcactggccaaa
ggaatcactgaagaatgtctgaaacagccatctttggaacagaaggaaggcagaagagct
tctcatacccttctcccaagccacagattgaaacagtcagctgattcatcctctagccgg
tcctcctcatcttcctcctccagttctagatcaagatctcgctctcctgacagttcaggt
tctcggtctcattcaccgctcagatccaagcagagagatgtagcccaggcacgtactcat
gccaaccctcgtggtagacccaagatgggctccagatcaacatcagagtccagatcaagg
tcacgttcacgttctcgttcagcatcaagcaacagcagaaaatctctgagccctggagtc
tccagggacagcagcaccagctatactgaaaccaaagatccctcttctggtcaggaggtt
gcaactccaccagtgccacaactgcaggtctgtgagccaaaggagaggacttccacctcc
tcatcctctgtccaagcaaggcgtctgagtcagcctgaatcagctgaaaagcatgtgacc
cagaggttacagcctgagcgggggagcccaaagaagtgtgaagctgaagaggcagagcca
ccagctgccacacagccccaaacctcagagactcagacctctcatctgccagaatcagaa
agaattcatcacactgttgaggagaaggaggaagtgaccatggacacaagtgaaaacaga
cctgaaaatgatgttccagaacctcccatgcctattgcagaccaagtcagcaatgatgac
cgcccggagggcagtgttgaagatgaggagaagaaagagagctcgctgcccaaatcattc
aagaggaagatctccgttgtctctaccaagggggtgccagctggaaacagtgacacagag
gggggccagcctggtcggaaacgacgctggggagccagcacagccaccacacagaagaaa
ccttccatcagtatcaccactgaatcactaaaggaggctgttgtggatcttcatgctgat
gactctcgcatctctgaggatgagacagagcgtaatggcgatgatgggacccatgacaag
gggctgaaaatatgccggacagtcactcaggtagtacctgcagagggccaggagaatggg
cagagggaagaagaggaagaagagaaggaacctgaagcagaacctcctgtacctccccag
gtgtcagtagaggtggccttgcccccacctgcagagcatgaagtaaagaaagtgacttta
ggagataccttaactcgacgttccattagccagcagaagtccggagtttccattaccatt
gatgacccagtccgaactgcccaggtgccctccccaccccggggcaagattagcaacatt
gtccatatctccaatttggtccgtcctttcactttaggccagctaaaggagttgttgggg
cgcacaggaaccttggtggaagaggccttctggattgacaagatcaaatctcattgcttt
gtaacgtactcaacagtagaggaagctgttgccacccgcacagctctgcacggggtcaaa
tggccccagtccaatcccaaattcctttgtgctgactatgccgagcaagatgagctggat
tatcaccgaggcctcttggtggaccgtccctctgaaactaagacagaggagcagggaata
ccacggcccctgcaccccccacccccacccccggtccagccaccacagcacccccgggca
gagcagcgggagcaggaacgggcagtgcgggaacagtgggcagaacgggaacgggaaatg
gagcggcgggagcggactcgatcagagcgtgaatgggatcgggacaaagttcgagaaggg
ccccgttcccgatcaaggtcccgtgaccgccgccgcaaggaacgtgcgaagtctaaagaa
aagaagagtgagaagaaagagaaagcccaggaggaaccacctgccaagctgctggatgac
cttttccgaaagaccaaggcagctccctgcatctattggctcccactgactgacagccag
atcgttcagaaagaggcagagcgggccgaacgggccaaggagcgggagaagcggcgaaag
gagcaagaagaagaagagcaaaaggagcgggagaaggaagccgagcgggaacggaaccga
cagctggagcgagagaaacgtcgggagcacagtcgggagagggacagggagagagagaga
gaaagggagcgggacaggggggaccgagatcgggatagggaaagggaccgagaacgaggc
agggaaagggatcgcagggacaccaagcgccacagcagaagccggagtcggagcacacct
gtgcgggaccggggtgggcgccgctag

DBGET integrated database retrieval system