KEGG   Homo sapiens (human): 22989Help
Entry
22989             CDS       T01001                                 

Gene name
MYH15
Definition
(RefSeq) myosin, heavy chain 15
  KO
K10352  
myosin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    22989 (MYH15)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   22989 (MYH15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
3q13.13
AA seq 1946 aa AA seqDB search
MVESCLLTFRAFFWWIALIKMDLSDLGEAAAFLRRSEAELLLLQATALDGKKKCWIPDGE
NAYIEAEVKGSEDDGTVIVETADGESLSIKEDKIQQMNPPEFEMIEDMAMLTHLNEASVL
HTLKRRYGQWMIYTYSGLFCVTINPYKWLPVYQKEVMAAYKGKRRSEAPPHIFAVANNAF
QDMLHNRENQSILFTGESGAGKTVNSKHIIQYFATIAAMIESRKKQGALEDQIMQANTIL
EAFGNAKTLRNDNSSRFGKFIRMHFGARGMLSSVDIDIYLLEKSRVIFQQAGERNYHIFY
QILSGQKELHDLLLVSANPSDFHFCSCGAVTVESLDDAEELLATEQAMDILGFLPDEKYG
CYKLTGAIMHFGNMKFKQKPREEQLEADGTENADKAAFLMGINSSELVKCLIHPRIKVGN
EYVTRGQTIEQVTCAVGALSKSMYERMFKWLVARINRALDAKLSRQFFIGILDITGFEIL
EYNSLEQLCINFTNEKLQQFFNWHMFVLEQEEYKKESIEWVSIGFGLDLQACIDLIEKPM
GILSILEEECMFPKATDLTFKTKLFDNHFGKSVHLQKPKPDKKKFEAHFELVHYAGVVPY
NISGWLEKNKDLLNETVVAVFQKSSNRLLASLFENYMSTDSAIPFGEKKRKKGASFQTVA
SLHKENLNKLMTNLKSTAPHFVRCINPNVNKIPGILDPYLVLQQLRCNGVLEGTRICREG
FPNRLQYADFKQRYCILNPRTFPKSKFVSSRKAAEELLGSLEIDHTQYRFGITKVFFKAG
FLGQLEAIRDERLSKVFTLFQARAQGKLMRIKFQKILEERDALILIQWNIRAFMAVKNWP
WMRLFFKIKPLVKSSEVGEEVAGLKEECAQLQKALEKSEFQREELKAKQVSLTQEKNDLI
LQLQAEQETLANVEEQCEWLIKSKIQLEARVKELSERVEEEEEINSELTARGRKLEDECF
ELKKEIDDLETMLVKSEKEKRTTEHKVKNLTEEVEFLNEDISKLNRAAKVVQEAHQQTLD
DLHMEEEKLSSLSKANLKLEQQVDELEGALEQERKARMNCERELHKLEGNLKLNRESMEN
LESSQRHLAEELRKKELELSQMNSKVENEKGLVAQLQKTVKELQTQIKDLKEKLEAERTT
RAKMERERADLTQDLADLNERLEEVGGSSLAQLEITKKQETKFQKLHRDMEEATLHFETT
SASLKKRHADSLAELEGQVENLQQVKQKLEKDKSDLQLEVDDLLTRVEQMTRAKANAEKL
CTLYEERLHEATAKLDKVTQLANDLAAQKTKLWSESGEFLRRLEEKEALINQLSREKSNF
TRQIEDLRGQLEKETKSQSALAHALQKAQRDCDLLREQYEEEQEVKAELHRTLSKVNAEM
VQWRMKYENNVIQRTEDLEDAKKELAIRLQEAAEAMGVANARNASLERARHQLQLELGDA
LSDLGKVRSAAARLDQKQLQSGKALADWKQKHEESQALLDASQKEVQALSTELLKLKNTY
EESIVGQETLRRENKNLQEEISNLTNQVREGTKNLTEMEKVKKLIEEEKTEVQVTLEETE
GALERNESKILHFQLELLEAKAELERKLSEKDEEIENFRRKQQCTIDSLQSSLDSEAKSR
IEVTRLKKKMEEDLNEMELQLSCANRQVSEATKSLGQLQIQIKDLQMQLDDSTQLNSDLK
EQVAVAERRNSLLQSELEDLRSLQEQTERGRRLSEEELLEATERINLFYTQNTSLLSQKK
KLEADVARMQKEAEEVVQECQNAEEKAKKAAIEAANLSEELKKKQDTIAHLERTRENMEQ
TITDLQKRLAEAEQMALMGSRKQIQKLESRVRELEGELEGEIRRSAEAQRGARRLERCIK
ELTYQAEEDKKNLSRMQTQMDKLQLKVQNYKQQVEVAETQANQYLSKYKKQQHELNEVKE
RAEVAESQVNKLKIKAREFGKKVQEE
NT seq 5841 nt NT seq  +upstreamnt  +downstreamnt
atggttgaatcttgcctactcacgtttagggcctttttttggtggattgctttaataaag
atggatctgtcagaccttggagaagccgcagccttcctcagaagaagtgaagctgagctg
cttctactacaggccacagccttggatgggaagaagaaatgctggattcctgatggtgag
aatgcttatatcgaggctgaggtaaaagggagtgaagatgatggaacagtaattgttgag
acagcagatggagagagtctgagcataaaggaggacaaaatccagcagatgaatcctcca
gagtttgaaatgattgaagacatggcaatgctgactcacctcaatgaggcatccgtgctg
cataccctgaagcggcgctatggccagtggatgatctatacatattcaggtctcttctgt
gtgaccataaacccttacaaatggcttcccgtgtatcagaaagaagtcatggccgcctac
aaagggaagaggcgatcagaggctccccctcacatctttgctgttgccaataacgccttt
caggacatgcttcacaatcgagaaaatcagtctatactcttcacaggagaatctggtgct
ggaaagactgtgaacagcaaacatattatccagtattttgccaccatagcagccatgatt
gaatccaggaaaaagcagggggcgttagaagatcaaatcatgcaagcgaatactatcttg
gaagcatttggaaatgctaaaaccctgagaaatgacaactcctctcgttttggcaaattc
atcaggatgcactttggtgccagaggcatgctgtcatctgtggacattgatatctatttg
cttgaaaagtccagggtgattttccagcaggctggagagaggaactaccacatattctat
caaattctatctggacaaaaagagcttcatgacctgctcctggtatctgcaaatccctca
gacttccacttttgctcctgtggagcagttactgtggagagcttggatgatgctgaagaa
ttgctggccacagaacaagccatggacatcttgggctttcttcctgatgagaagtatgga
tgctataaactcactggagccatcatgcactttggaaatatgaaatttaaacagaaacct
agagaagagcaactggaagcagatggcacagaaaatgctgacaaagctgctttcctcatg
ggcattaactcctctgagttggtaaagtgcttgatccatcctagaatcaaagttggtaac
gaatatgttaccagaggtcaaactatagaacaggtaacctgtgctgtcggtgccctgtcc
aagtcaatgtatgaaaggatgtttaagtggctagtggcacggatcaacagggccctggat
gccaagctgtcaaggcagttcttcattggcattcttgacatcactggttttgaaatcctt
gagtataatagccttgagcaactttgcattaattttaccaatgaaaaattacaacaattc
ttcaattggcacatgtttgttctggagcaagaggaatataagaaagaaagcattgaatgg
gtgtctattggctttggtctggatttgcaagcttgcatagatctcattgagaagccaatg
ggcatcctttccatccttgaagaagagtgtatgtttcctaaggctacagacctgactttc
aagaccaaactctttgacaaccattttggaaagtcggttcatctccagaagcccaagcct
gataagaagaaatttgaagctcattttgaacttgtccattatgcaggagtggtaccttat
aatatcagtggttggctggaaaagaacaaagacctccttaatgaaacagtggtagctgta
tttcagaagtcttccaacagactcctggcgagcctttttgaaaattacatgagtactgac
agtgctataccatttggggagaagaaacgaaagaaaggagcttcattccaaacggttgca
tctctgcataaagaaaacctgaataaattgatgactaatctgaaatcaacagcacctcat
tttgtgagatgcataaatcccaatgtgaacaaaataccaggtatactggacccttacttg
gttctacagcagttgcgctgtaatggtgtcttggaagggactaggatatgccgtgaaggt
tttccaaaccgactgcagtatgctgattttaaacaaaggtactgcattctgaatccaagg
acctttccaaagagcaagtttgtgagcagcagaaaagcagctgaagaattacttggctcc
ttggagatagaccatacccagtaccgatttggaatcactaaggtgttttttaaagctggg
tttctgggccaactggaagcaataagagatgagagactatctaaagtcttcacattgttc
caagccagagcacagggcaaactgatgcgaatcaaattccagaagattctggaagaaagg
gatgcacttattttgatccaatggaacataagagctttcatggctgtgaagaactggccc
tggatgaggctcttcttcaagatcaagcctcttgttaaatcttcagaagtaggagaagaa
gtagctggactgaaggaagagtgtgcacaattacagaaagccttggagaaatcagagttt
cagagggaggaactgaaagcaaagcaagtatccctcactcaggaaaaaaatgacctgatt
cttcagcttcaggctgagcaagagacactggcaaatgttgaagagcagtgcgagtggctg
attaaatccaagatccagctggaggccagagtaaaggagctgtcggagagggtggaggaa
gaagaggagataaattctgagctgactgccagggggcggaaactcgaagatgaatgtttt
gagttgaagaaagaaatcgatgacctggaaacaatgttggtgaagtcagagaaggagaag
cgtactacagagcacaaggtcaagaacttgactgaggaagtagagtttctaaatgaggat
atcagcaaacttaacagagcagccaaggttgtgcaggaggcccatcagcagaccctggat
gacctgcacatggaggaggagaagctcagcagcctgagcaaagcaaatctgaagctggaa
cagcaagttgatgagcttgagggtgcccttgagcaggagagaaaagcgagaatgaactgt
gaaagggaactgcacaaactggagggcaatttaaagctgaatcgggaaagtatggagaac
ctggaaagcagccagcgacacctggcagaagagctgaggaaaaaagaattagaattgagt
cagatgaattcaaaagtggagaatgagaaaggcctggtagctcagcttcagaagacggtt
aaagagcttcagactcaaataaaggatttgaaagagaaactagaagctgaaaggaccact
cgagccaagatggaaagggagagagctgacctcacccaagacctggctgacttgaatgag
aggctggaggaggtaggaggatccagtttggctcagctggaaataactaagaaacaggaa
accaaattccagaagctgcaccgagacatggaagaggccactctgcactttgagacaact
tctgcatctttgaagaagagacatgcagacagcctggctgagctcgagggccaggtagaa
aatctacagcaggtcaagcagaaactggaaaaagacaagagtgacttgcagctagaagta
gatgacctcctgacccgtgttgagcagatgacaagagctaaggcaaatgctgagaaactc
tgtactctatatgaagagcgcttgcatgaagcaactgcaaagctagataaggtgactcag
ttggcaaatgacctggcagcacaaaagacaaagctgtggagtgagagtggcgagttccta
cggaggcttgaagagaaggaggctctgataaaccaactttccagggaaaagagcaacttc
actcggcagattgaagacctgagagggcagctggaaaaggagaccaaatcccagagtgcc
ctggcccatgccctgcagaaggctcagcgtgactgtgaccttctacgagagcagtatgag
gaagaacaagaggtcaaggctgagctgcaccggaccttatccaaagtcaatgctgaaatg
gtgcaatggagaatgaagtatgaaaacaatgtcatccagagaacagaagacttggaggat
gccaagaaggaactggcaattagattgcaggaggcagccgaagccatgggggtggccaat
gccagaaatgcctccttggagagagccaggcaccagctgcagctggagctcggggacgcc
ctgtctgacctcgggaaggtccgctctgcagcagccaggctggaccagaagcagctgcag
tctggcaaggcccttgccgactggaagcagaagcacgaggagtcccaggcgttgctggat
gcctctcagaaggaagttcaggctctcagtacagagctcctcaagctcaagaacacctat
gaggagagcatcgtgggccaggagacactcaggagggagaacaagaacctccaagaagag
atttctaatctgacaaaccaggttagagaagggaccaagaacttaactgaaatggaaaag
gtcaagaaactaattgaagaagagaagacagaagtccaggtgacactggaagaaacagag
ggagccctggaacgtaatgaaagcaagattcttcatttccagcttgaactcttggaagct
aaagcagaacttgaaagaaagctttcagagaaagatgaagaaatagaaaattttaggagg
aagcagcagtgtaccattgactccctgcagtctagtctggattctgaagctaagagcaga
attgaggttacccggctgaagaagaagatggaagaggacctcaatgagatggaactccag
cttagctgtgccaaccggcaggtgtcagaagcaaccaaatccctgggccagcttcagatt
caaatcaaggaccttcaaatgcagctggatgacagcacacaactgaacagtgatctgaag
gagcaggtggctgtggctgagcggcgcaactctcttcttcagtctgaactagaggatcta
aggtccctgcaagagcagacagagcgtggccgcaggctgtcagaagaagagctcctggaa
gcaacagaaagaatcaatcttttctatacccagaacacaagcctcctcagccagaagaag
aaactggaggctgatgttgcccggatgcagaaagaagctgaagaggtggtgcaggagtgt
caaaatgcagaagagaaggccaagaaggcagccattgaggcagcaaacttgtcagaagaa
ctgaagaagaagcaagacaccattgcccacttggaaaggacaagagaaaatatggagcag
acaattacagacttacagaaaaggctggctgaagctgaacagatggccctgatggggagt
agaaagcaaatccagaaactagaatccagggttcgtgaactggaaggtgaactggagggt
gaaatccgtcgcagtgcagaggcccagaggggagcccgcagacttgagcgatgcatcaaa
gagctgacctatcaggcagaggaagacaagaagaatctgagcaggatgcaaactcagatg
gataaacttcagctaaaagtgcaaaattacaagcagcaagtcgaggtggcggaaacacaa
gccaatcaatacctttccaagtataagaaacagcaacatgagttgaatgaagtgaaggaa
agggcagaggtggcagaatctcaagtcaataaactcaaaattaaagcaagagagtttggg
aaaaaggttcaagaagaatag

DBGET integrated database retrieval system