KEGG   Homo sapiens (human): 22989Help
Entry
22989             CDS       T01001                                 

Gene name
MYH15
Definition
myosin, heavy chain 15
Orthology
K10352  
myosin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    22989 (MYH15)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   22989 (MYH15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
3q13.13
AA seq 1946 aa AA seqDB search
MVESCLLTFRAFFWWIALIKMDLSDLGEAAAFLRRSEAELLLLQATALDGKKKCWIPDGE
NAYIEAEVKGSEDDGTVIVETADGESLSIKEDKIQQMNPPEFEMIEDMAMLTHLNEASVL
HTLKRRYGQWMIYTYSGLFCVTINPYKWLPVYQKEVMAAYKGKRRSEAPPHIFAVANNAF
QDMLHNRENQSILFTGESGAGKTVNSKHIIQYFATIAAMIESRKKQGALEDQIMQANTIL
EAFGNAKTLRNDNSSRFGKFIRMHFGARGMLSSVDIDIYLLEKSRVIFQQAGERNYHIFY
QILSGQKELHDLLLVSANPSDFHFCSCGAVTVESLDDAEELLATEQAMDILGFLPDEKYG
CYKLTGAIMHFGNMKFKQKPREEQLEADGTENADKAAFLMGINSSELVKCLIHPRIKVGN
EYVTRGQTIEQVTCAVGALSKSMYERMFKWLVARINRALDAKLSRQFFIGILDITGFEIL
EYNSLEQLCINFTNEKLQQFFNWHMFVLEQEEYKKESIEWVSIGFGLDLQACIDLIEKPM
GILSILEEECMFPKATDLTFKTKLFDNHFGKSVHLQKPKPDKKKFEAHFELVHYAGVVPY
NISGWLEKNKDLLNETVVAVFQKSSNRLLASLFENYMSTDSAIPFGEKKRKKGASFQTVA
SLHKENLNKLMTNLKSTAPHFVRCINPNVNKIPGILDPYLVLQQLRCNGVLEGTRICREG
FPNRLQYADFKQRYCILNPRTFPKSKFVSSRKAAEELLGSLEIDHTQYRFGITKVFFKAG
FLGQLEAIRDERLSKVFTLFQARAQGKLMRIKFQKILEERDALILIQWNIRAFMAVKNWP
WMRLFFKIKPLVKSSEVGEEVAGLKEECAQLQKALEKSEFQREELKAKQVSLTQEKNDLI
LQLQAEQETLANVEEQCEWLIKSKIQLEARVKELSERVEEEEEINSELTARGRKLEDECF
ELKKEIDDLETMLVKSEKEKRTTEHKVKNLTEEVEFLNEDISKLNRAAKVVQEAHQQTLD
DLHMEEEKLSSLSKANLKLEQQVDELEGALEQERKARMNCERELHKLEGNLKLNRESMEN
LESSQRHLAEELRKKELELSQMNSKVENEKGLVAQLQKTVKELQTQIKDLKEKLEAERTT
RAKMERERADLTQDLADLNERLEEVGGSSLAQLEITKKQETKFQKLHRDMEEATLHFETT
SASLKKRHADSLAELEGQVENLQQVKQKLEKDKSDLQLEVDDLLTRVEQMTRAKANAEKL
CTLYEERLHEATAKLDKVTQLANDLAAQKTKLWSESGEFLRRLEEKEALINQLSREKSNF
TRQIEDLRGQLEKETKSQSALAHALQKAQRDCDLLREQYEEEQEVKAELHRTLSKVNAEM
VQWRMKYENNVIQRTEDLEDAKKELAIRLQEAAEAMGVANARNASLERARHQLQLELGDA
LSDLGKVRSAAARLDQKQLQSGKALADWKQKHEESQALLDASQKEVQALSTELLKLKNTY
EESIVGQETLRRENKNLQEEISNLTNQVREGTKNLTEMEKVKKLIEEEKTEVQVTLEETE
GALERNESKILHFQLELLEAKAELERKLSEKDEEIENFRRKQQCTIDSLQSSLDSEAKSR
IEVTRLKKKMEEDLNEMELQLSCANRQVSEATKSLGQLQIQIKDLQMQLDDSTQLNSDLK
EQVAVAERRNSLLQSELEDLRSLQEQTERGRRLSEEELLEATERINLFYTQNTSLLSQKK
KLEADVARMQKEAEEVVQECQNAEEKAKKAAIEAANLSEELKKKQDTIAHLERTRENMEQ
TITDLQKRLAEAEQMALMGSRKQIQKLESRVRELEGELEGEIRRSAEAQRGARRLERCIK
ELTYQAEEDKKNLSRMQTQMDKLQLKVQNYKQQVEVAETQANQYLSKYKKQQHELNEVKE
RAEVAESQVNKLKIKAREFGKKVQEE
NT seq 5841 nt NT seq  +upstreamnt  +downstreamnt
atggttgaatcttgcctactcacgtttagggcctttttttggtggattgctttaataaag
atggatctgtcagaccttggagaagccgcagccttcctcagaagaagtgaagctgagctg
cttctactacaggccacagccttggatgggaagaagaaatgctggattcctgatggtgag
aatgcttatatcgaggctgaggtaaaagggagtgaagatgatggaacagtaattgttgag
acagcagatggagagagtctgagcataaaggaggacaaaatccagcagatgaatcctcca
gagtttgaaatgattgaagacatggcaatgctgactcacctcaatgaggcatccgtgctg
cataccctgaagcggcgctatggccagtggatgatctatacatattcaggtctcttctgt
gtgaccataaacccttacaaatggcttcccgtgtatcagaaagaagtcatggccgcctac
aaagggaagaggcgatcagaggctccccctcacatctttgctgttgccaataacgccttt
caggacatgcttcacaatcgagaaaatcagtctatactcttcacaggagaatctggtgct
ggaaagactgtgaacagcaaacatattatccagtattttgccaccatagcagccatgatt
gaatccaggaaaaagcagggggcgttagaagatcaaatcatgcaagcgaatactatcttg
gaagcatttggaaatgctaaaaccctgagaaatgacaactcctctcgttttggcaaattc
atcaggatgcactttggtgccagaggcatgctgtcatctgtggacattgatatctatttg
cttgaaaagtccagggtgattttccagcaggctggagagaggaactaccacatattctat
caaattctatctggacaaaaagagcttcatgacctgctcctggtatctgcaaatccctca
gacttccacttttgctcctgtggagcagttactgtggagagcttggatgatgctgaagaa
ttgctggccacagaacaagccatggacatcttgggctttcttcctgatgagaagtatgga
tgctataaactcactggagccatcatgcactttggaaatatgaaatttaaacagaaacct
agagaagagcaactggaagcagatggcacagaaaatgctgacaaagctgctttcctcatg
ggcattaactcctctgagttggtaaagtgcttgatccatcctagaatcaaagttggtaac
gaatatgttaccagaggtcaaactatagaacaggtaacctgtgctgtcggtgccctgtcc
aagtcaatgtatgaaaggatgtttaagtggctagtggcacggatcaacagggccctggat
gccaagctgtcaaggcagttcttcattggcattcttgacatcactggttttgaaatcctt
gagtataatagccttgagcaactttgcattaattttaccaatgaaaaattacaacaattc
ttcaattggcacatgtttgttctggagcaagaggaatataagaaagaaagcattgaatgg
gtgtctattggctttggtctggatttgcaagcttgcatagatctcattgagaagccaatg
ggcatcctttccatccttgaagaagagtgtatgtttcctaaggctacagacctgactttc
aagaccaaactctttgacaaccattttggaaagtcggttcatctccagaagcccaagcct
gataagaagaaatttgaagctcattttgaacttgtccattatgcaggagtggtaccttat
aatatcagtggttggctggaaaagaacaaagacctccttaatgaaacagtggtagctgta
tttcagaagtcttccaacagactcctggcgagcctttttgaaaattacatgagtactgac
agtgctataccatttggggagaagaaacgaaagaaaggagcttcattccaaacggttgca
tctctgcataaagaaaacctgaataaattgatgactaatctgaaatcaacagcacctcat
tttgtgagatgcataaatcccaatgtgaacaaaataccaggtatactggacccttacttg
gttctacagcagttgcgctgtaatggtgtcttggaagggactaggatatgccgtgaaggt
tttccaaaccgactgcagtatgctgattttaaacaaaggtactgcattctgaatccaagg
acctttccaaagagcaagtttgtgagcagcagaaaagcagctgaagaattacttggctcc
ttggagatagaccatacccagtaccgatttggaatcactaaggtgttttttaaagctggg
tttctgggccaactggaagcaataagagatgagagactatctaaagtcttcacattgttc
caagccagagcacagggcaaactgatgcgaatcaaattccagaagattctggaagaaagg
gatgcacttattttgatccaatggaacataagagctttcatggctgtgaagaactggccc
tggatgaggctcttcttcaagatcaagcctcttgttaaatcttcagaagtaggagaagaa
gtagctggactgaaggaagagtgtgcacaattacagaaagccttggagaaatcagagttt
cagagggaggaactgaaagcaaagcaagtatccctcactcaggaaaaaaatgacctgatt
cttcagcttcaggctgagcaagagacactggcaaatgttgaagagcagtgcgagtggctg
attaaatccaagatccagctggaggccagagtaaaggagctgtcggagagggtggaggaa
gaagaggagataaattctgagctgactgccagggggcggaaactcgaagatgaatgtttt
gagttgaagaaagaaatcgatgacctggaaacaatgttggtgaagtcagagaaggagaag
cgtactacagagcacaaggtcaagaacttgactgaggaagtagagtttctaaatgaggat
atcagcaaacttaacagagcagccaaggttgtgcaggaggcccatcagcagaccctggat
gacctgcacatggaggaggagaagctcagcagcctgagcaaagcaaatctgaagctggaa
cagcaagttgatgagcttgagggtgcccttgagcaggagagaaaagcgagaatgaactgt
gaaagggaactgcacaaactggagggcaatttaaagctgaatcgggaaagtatggagaac
ctggaaagcagccagcgacacctggcagaagagctgaggaaaaaagaattagaattgagt
cagatgaattcaaaagtggagaatgagaaaggcctggtagctcagcttcagaagacggtt
aaagagcttcagactcaaataaaggatttgaaagagaaactagaagctgaaaggaccact
cgagccaagatggaaagggagagagctgacctcacccaagacctggctgacttgaatgag
aggctggaggaggtaggaggatccagtttggctcagctggaaataactaagaaacaggaa
accaaattccagaagctgcaccgagacatggaagaggccactctgcactttgagacaact
tctgcatctttgaagaagagacatgcagacagcctggctgagctcgagggccaggtagaa
aatctacagcaggtcaagcagaaactggaaaaagacaagagtgacttgcagctagaagta
gatgacctcctgacccgtgttgagcagatgacaagagctaaggcaaatgctgagaaactc
tgtactctatatgaagagcgcttgcatgaagcaactgcaaagctagataaggtgactcag
ttggcaaatgacctggcagcacaaaagacaaagctgtggagtgagagtggcgagttccta
cggaggcttgaagagaaggaggctctgataaaccaactttccagggaaaagagcaacttc
actcggcagattgaagacctgagagggcagctggaaaaggagaccaaatcccagagtgcc
ctggcccatgccctgcagaaggctcagcgtgactgtgaccttctacgagagcagtatgag
gaagaacaagaggtcaaggctgagctgcaccggaccttatccaaagtcaatgctgaaatg
gtgcaatggagaatgaagtatgaaaacaatgtcatccagagaacagaagacttggaggat
gccaagaaggaactggcaattagattgcaggaggcagccgaagccatgggggtggccaat
gccagaaatgcctccttggagagagccaggcaccagctgcagctggagctcggggacgcc
ctgtctgacctcgggaaggtccgctctgcagcagccaggctggaccagaagcagctgcag
tctggcaaggcccttgccgactggaagcagaagcacgaggagtcccaggcgttgctggat
gcctctcagaaggaagttcaggctctcagtacagagctcctcaagctcaagaacacctat
gaggagagcatcgtgggccaggagacactcaggagggagaacaagaacctccaagaagag
atttctaatctgacaaaccaggttagagaagggaccaagaacttaactgaaatggaaaag
gtcaagaaactaattgaagaagagaagacagaagtccaggtgacactggaagaaacagag
ggagccctggaacgtaatgaaagcaagattcttcatttccagcttgaactcttggaagct
aaagcagaacttgaaagaaagctttcagagaaagatgaagaaatagaaaattttaggagg
aagcagcagtgtaccattgactccctgcagtctagtctggattctgaagctaagagcaga
attgaggttacccggctgaagaagaagatggaagaggacctcaatgagatggaactccag
cttagctgtgccaaccggcaggtgtcagaagcaaccaaatccctgggccagcttcagatt
caaatcaaggaccttcaaatgcagctggatgacagcacacaactgaacagtgatctgaag
gagcaggtggctgtggctgagcggcgcaactctcttcttcagtctgaactagaggatcta
aggtccctgcaagagcagacagagcgtggccgcaggctgtcagaagaagagctcctggaa
gcaacagaaagaatcaatcttttctatacccagaacacaagcctcctcagccagaagaag
aaactggaggctgatgttgcccggatgcagaaagaagctgaagaggtggtgcaggagtgt
caaaatgcagaagagaaggccaagaaggcagccattgaggcagcaaacttgtcagaagaa
ctgaagaagaagcaagacaccattgcccacttggaaaggacaagagaaaatatggagcag
acaattacagacttacagaaaaggctggctgaagctgaacagatggccctgatggggagt
agaaagcaaatccagaaactagaatccagggttcgtgaactggaaggtgaactggagggt
gaaatccgtcgcagtgcagaggcccagaggggagcccgcagacttgagcgatgcatcaaa
gagctgacctatcaggcagaggaagacaagaagaatctgagcaggatgcaaactcagatg
gataaacttcagctaaaagtgcaaaattacaagcagcaagtcgaggtggcggaaacacaa
gccaatcaatacctttccaagtataagaaacagcaacatgagttgaatgaagtgaaggaa
agggcagaggtggcagaatctcaagtcaataaactcaaaattaaagcaagagagtttggg
aaaaaggttcaagaagaatag

DBGET integrated database retrieval system