KEGG   Homo sapiens (human): 22999Help
Entry
22999             CDS       T01001                                 

Gene name
RIMS1, CORD7, RAB3IP2, RIM, RIM1
Definition
(RefSeq) regulating synaptic membrane exocytosis 1
  KO
K15291  
regulating synaptic membrane exocytosis protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Synaptic vesicle cycle
Retrograde endocannabinoid signaling
Disease
H00481  
Cone-rod dystrophy and cone dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    22999 (RIMS1)
   04721 Synaptic vesicle cycle
    22999 (RIMS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q12-q13
AA seq 1692 aa AA seqDB search
MSSAVGPRGPRPPTVPPPMQELPDLSHLTEEERNIIMAVMDRQKEEEEKEEAMLKCVVRD
MAKPAACKTPRNAENQPHQPSPRLHQQFESYKEQVRKIGEEARRYQGEHKDDAPTCGICH
KTKFADGCGHLCSYCRTKFCARCGGRVSLRSNNEDKVVMWVCNLCRKQQEILTKSGAWFF
GSGPQQTSQDGTLSDTATGAGSEVPREKKARLQERSRSQTPLSTAAASSQDAAPPSAPPD
RSKGAEPSQQALGPEQKQASSRSRSEPPRERKKTPGLSEQNGKGALKSERKRVPKTSAQP
VEGAVEERERKERRESRRLEKGRSQDYPDTPEKRDEGKAADEEKQRKEEDYQTRYRSDPN
LARYPVKPPPEEQQMRMHARVSRARHERRHSDVALPRTEAGAALPEGKAGKRAPAAARAS
PPDSPRAYSAERTAETRAPGAKQLTNHSPPAPRHGPVPAEAPELKAQEPLRKQSRLDPSS
AVLMRKAKREKVETMLRNDSLSSDQSESVRPSPPKPHRSKRGGKKRQMSVSSSEEEGVST
PEYTSCEDVELESESVSEKGDLDYYWLDPATWHSRETSPISSHPVTWQPSKEGDRLIGRV
ILNKRTTMPKDSGALLGLKVVGGKMTDLGRLGAFITKVKKGSLADVVGHLRAGDEVLEWN
GKPLPGATNEEVYNIILESKSEPQVEIIVSRPIGDIPRIPESSHPPLESSSSSFESQKME
RPSISVISPTSPGALKDAPQVLPGQLSVKLWYDKVGHQLIVNVLQATDLPARVDGRPRNP
YVKMYFLPDRSDKSKRRTKTVKKILEPKWNQTFVYSHVHRRDFRERMLEITVWDQPRVQE
EESEFLGEILIELETALLDDEPHWYKLQTHDESSLPLPQPSPFMPRRHIHGESSSKKLQR
SQRISDSDISDYEVDDGIGVVPPVGYRSSARESKSTTLTVPEQQRTTHHRSRSVSPHRGN
DQGKPRSRLPNVPLQRSLDEIHPTRRSRSPTRHHDASRSPVDHRTRDVDSQYLSEQDSEL
LMLPRAKRGRSAECLHTTRHLVRHYKTLPPKMPLLQSSSHWNIYSSILPAHTKTKSVTRQ
DISLHHECFNSTVLRFTDEILVSELQPFLDRARSASTNCLRPDTSLHSPERERGRWSPSL
DRRRPPSPRIQIQHASPENDRHSRKSERSSIQKQTRKGTASDAERVLPTCLSRRGHAAPR
ATDQPVIRGKHPARSRSSEHSSIRTLCSMHHLVPGGSAPPSPLLTRMHRQRSPTQSPPAD
TSFSSRRGRQLPQVPVRSGSIEQASLVVEERTRQMKMKVHRFKQTTGSGSSQELDREQYS
KYNIHKDQYRSCDNVSAKSSDSDVSDVSAISRTSSASRLSSTSFMSEQSERPRGRISSFT
PKMQGRRMGTSGRSIMKSTSVSGEMYTLEHNDGSQSDTAVGTVGAGGKKRRSSLSAKVVA
IVSRRSRSTSQLSQTESGHKKLKSTIQRSTETGMAAEMRKMVRQPSRESTDGSINSYSSE
GNLIFPGVRLGADSQFSDFLDGLGPAQLVGRQTLATPAMGDIQIGMEDKKGQLEVEVIRA
RSLTQKPGSKSTPAPYVKVYLLENGACIAKKKTRIARKTLDPLYQQSLVFDESPQGKVLQ
VIVWGDYGRMDHKCFMGVAQILLEELDLSSMVIGWYKLFPPSSLVDPTLTPLTRRASQSS
LESSTGPPCIRS
NT seq 5079 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcggccgtggggccccgcggtcctcgcccacccacggtgcctccccccatgcaa
gagctgcccgacctgagccacctgaccgaagaggagaggaacattatcatggcagtgatg
gaccggcagaaggaagaggaggaaaaagaagaagccatgctcaagtgtgttgtcagggac
atggcgaagcctgctgcctgcaaaacaccaagaaatgctgaaaaccagccccaccaacct
tcaccgagattgcatcaacagtttgaaagctataaggaacaagtgagaaaaataggggaa
gaagcgcggcgttaccagggcgagcacaaagacgatgctccgacttgtggaatctgtcat
aaaacaaagtttgctgatgggtgcggtcatctctgctcctattgtcgcactaagttctgt
gcgcgctgcggaggccgcgtgtctctacggtcaaacaacgaggacaaagtggttatgtgg
gtatgcaatttatgtcgaaagcaacaagaaatcttaaccaaatctggggcatggttcttt
ggaagtggccctcagcagacaagtcaggatggaaccctgagtgatacagctacaggtgct
ggctctgaggtaccaagagaaaagaaagcacgactccaagagcgatcgcggtctcagaca
cccctaagcacagcagctgcctcctcccaggatgctgctcctcccagcgcaccaccagac
aggagcaaaggggctgagccctcgcagcaagccttggggcctgaacagaagcaggcttca
tccaggtctagaagtgaacctcctagagagagaaagaagaccccagggctttccgagcag
aatggcaaaggagccctgaagagcgagcggaaacgcgtgccaaagacctcagcgcagccc
gtggagggggccgtcgaagaacgggagcgcaaagaaaggcgggaaagccgaaggcttgag
aaagggcgatcacaggattacccagacacgccggaaaaacgggatgagggcaaagcggcg
gatgaggaaaagcaaagaaaagaggaggattatcagaccaggtaccgcagcgacccgaac
ctagctcggtacccggtgaaaccgccgcctgaggagcagcagatgcgcatgcacgcccgg
gtgtcccgcgccaggcacgagcggcgccacagcgacgtggcgctcccgcgcaccgaggcg
ggcgcggcgctgccggagggcaaggccggcaaacgcgcgccggcggcagccagggcctcg
ccgccggactcgccgcgggcttactcggctgagagaactgcggagaccagggcgccgggc
gccaagcagctaacgaaccacagcccgccggcgcccagacatgggccggttcccgcagaa
gccccggagctcaaagcccaggagcccctcaggaagcagagccgcctggaccccagctcg
gcggtcctcatgcggaaggccaagcgcgagaaggtggagaccatgctgcggaacgactct
ttgagctcagaccagtccgagtcggtgcggccgtccccgcccaagccgcaccggtccaag
agaggcggcaagaagcggcagatgtcggtgagcagctctgaggaggagggcgtgtcgacg
cccgagtacaccagctgcgaggacgtggagctggagagcgagagcgtcagcgagaaaggt
gatttggattattactggttggatcctgccacgtggcacagccgggagacatcacctatt
agttcgcatcctgtaacgtggcaaccatctaaagagggggaccgattaattggacgtgtt
attcttaacaagagaacaaccatgcccaaagactcaggtgcattgctgggtctgaaagtt
gttggaggaaaaatgactgacttaggacgacttggtgctttcatcaccaaagtaaagaag
ggtagcctagcagatgtagttggacacctaagagcaggggatgaagttctagaatggaat
ggtaaacccctgccgggagctacaaatgaagaagtttacaacattattttagaatcaaaa
tcagaacctcaagttgaaattattgtttcaaggcctattggtgacattccccggattcct
gagagctcccaccctccactggagtccagttcaagttcctttgaatctcagaagatggaa
aggccttccatttctgttatttctccaacaagtcctggagctctaaaagatgccccacaa
gtcttaccagggcaactttctgtgaagttgtggtatgataaagtgggacaccagctgatt
gtaaatgttctgcaagcaacagatctacctgctagagtagatggacgtcctcgaaatccc
tatgtaaaaatgtattttcttccagatagaagtgataaaagtaaaaggaggaccaaaaca
gtaaagaaaatactagaaccaaaatggaatcaaacttttgtctattcacatgtacatcgt
agagattttagagaacgaatgttagaaataactgtgtgggaccaaccaagagtgcaagaa
gaagaaagtgaatttcttggagagatcctcatagaattggagacagcgcttttagatgat
gaaccgcattggtataaacttcagacacatgatgagtcttcactacctctgcctcagcca
tcacctttcatgccaaggcgacatattcatggagaaagctctagcaaaaagctacaaaga
tctcagcgaatcagtgatagtgacatctcagattatgaggttgatgatggtattggcgta
gttcctccagtaggctataggtctagtgctagagaaagtaaatctacaacattaactgtg
ccagaacagcaaagaacaactcatcaccgctcacgttcagtatctcctcatcgcggcaat
gatcagggaaagccgcgttcacgtttaccaaatgtgccattacagaggagtttagatgaa
attcatccaacaagaaggtcacgttctccaaccagacaccatgatgcctcccgaagtcca
gttgatcatagaaccagagatgtggatagtcagtatttatcagaacaagacagtgagctt
cttatgctgcccagagcaaaacgaggacgaagtgcagaatgcctacatactaccagacat
cttgttaggcactataaaacattacctcccaagatgcctttattacagagcagttctcac
tggaatatttacagctcaattctgcctgcacatactaagaccaaatcagtgactagacag
gacatttcccttcatcatgaatgctttaactcaacagtattgagatttactgatgaaata
ctggttagtgaactgcagccctttcttgacagggctaggagtgctagtaccaactgcttg
agaccagatactagtttgcattcaccagaacgagaaaggggtagatggtccccctcccta
gataggagacgacctcctagtcccaggattcaaatccagcatgcgtctccggagaatgac
aggcactccagaaagtctgaaagatctagcatccaaaaacagactaggaaaggcactgcc
tctgatgcagaaagggttctcccaacatgtctttctagaaggggacacgcagccccaaga
gcaactgatcagccagtcattaggggaaaacatcctgctcgctcaaggtcgagtgagcac
tctagtatcagaacactgtgttctatgcaccaccttgtccctggagggtcggcgccacct
tctccgcttctgacaagaatgcaccgacagagaagtccaacacaatctcctccagcagac
acatcgttcagcagtcgcaggggaagacagctcccacaagtgccagtgagaagcggcagt
atagaacaagcaagcttagtagtggaggagcgaacaagacagatgaaaatgaaagtgcat
cgatttaagcagacaacagggtctggttctagtcaagaacttgatcgcgagcaatattcc
aagtataacatacataaagatcagtacagaagctgtgataacgtctctgccaaatcatca
gatagtgatgtcagtgatgtttccgccatttcccgaaccagcagtgcctcacgcctcagc
agcacaagctttatgtcagagcaatctgagcgccccaggggtagaatcagttcatttacc
cccaaaatgcaaggcagacggatggggacttcaggaagatccatcatgaagagcaccagt
gtcagtggagagatgtacacactggagcataatgacggcagccagtcagacacagctgtg
ggtacagttggagcaggtggaaagaaacggagatccagccttagtgccaaagtggttgcc
atagtgtctcgaaggagtagaagcacatcccagcttagtcaaacagagtcgggccacaaa
aagttaaaaagtaccatccagagaagcacagaaacaggcatggcagctgaaatgagaaag
atggtaaggcagccgagccgagagtctactgatggcagcatcaacagttacagctctgag
ggcaatttaatatttcctggagtgcgactgggagctgacagtcaattcagtgattttctt
gatggattgggaccagcccagcttgttggccgccaaacccttgccacccctgcaatgggt
gatatacaaataggaatggaggacaaaaagggccaattagaagtggaagtcattagagca
cgaagcctcacacaaaagcctggttccaaatctacacctgctccatatgtcaaagtatat
cttttggaaaatggggcctgtatagccaagaagaagacaagaattgcacgaaaaaccctt
gatcctttgtatcagcagtctctggtttttgatgaaagtccacagggtaaagttcttcag
gtgattgtctggggagactatggcagaatggaccacaaatgctttatgggtgtggctcag
atcttgttggaagaactcgacctgtccagcatggtgatcggatggtacaaattgttccca
ccgtcctcactggtggatcccacactcactcccctcacccggcgggcttcccagtcatct
ctggaaagttcaactgggcctccctgtattcgatcatag

DBGET integrated database retrieval system