KEGG   Homo sapiens (human): 23020Help
Entry
23020             CDS       T01001                                 

Gene name
SNRNP200, ASCC3L1, BRR2, HELIC2, RP33, U5-200KD
Definition
small nuclear ribonucleoprotein 200kDa (U5) (EC:3.6.4.13)
Orthology
K12854  
pre-mRNA-splicing helicase BRR2 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, 35S U5-snRNP
Disease
H00527  
Retinitis pigmentosa (RP)
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:hsa03040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q11.2
AA seq 2136 aa AA seqDB search
MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTK
PQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFI
QAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKIT
DYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTL
SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDR
ECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFL
YQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFTQGS
HFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKT
LNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIY
IAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKG
GERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATLPNYED
VATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQ
VLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPY
GFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGR
WTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDM
LNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTA
ALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSL
SSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMAD
MVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKLPEEVV
KKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKV
ELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFE
PLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESL
YQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQSSEGRCVYIT
PMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWK
QRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDV
AHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVI
VFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKETLLNGVGYL
HEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYP
IYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEI
VTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSK
CISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPI
RHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAI
RLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVE
SVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQ
LEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKLDFVAPATG
AHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD
NT seq 6411 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgtaaccgcccgtagtctgcaatacgagtacaaggcgaactcgaatcttgtg
ctccaagctgaccgttctctcattgaccggacccgccgggatgaacccacaggagaggtg
ctgtcccttgttgggaagctggagggcacccgtatgggagacaaggctcaacggaccaaa
ccgcagatgcaggaggaaagaagagccaagcgaagaaagcgtgatgaggaccggcatgac
atcaacaagatgaagggttatactctgctgtcggagggcattgatgagatggtgggcatc
atctacaagcccaaaactaaagagactcgggagacctatgaggtgctactcagcttcatc
caggctgctcttggggaccagccacgtgatatcctttgtggggcagctgatgaagttcta
gctgttctaaagaatgaaaagctgcgggacaaggaaaggcgaaaggagattgacctgctg
ctgggtcaaacagatgataccagataccatgtgctagtgaacctgggcaaaaagatcaca
gactatggtggagataaggaaatccaaaatatggatgacaacattgatgagacatacggt
gtgaatgtgcagtttgagtctgatgaggaggaaggtgatgaagacgtatacggggaggtt
cgagaagaggcatctgatgatgacatggaaggggacgaggctgtcgtgcgctgcaccctc
tcggctaatctcgtagcctcaggtgaactgatgagttccaagaagaaggatttgcaccct
cgggatattgatgcattttggctgcagcggcagctcagtcgtttctatgatgatgccatc
gtgtcgcagaagaaggcagatgaagtattggagattttgaagacggccagtgatgatcgg
gaatgtgaaaatcagctggttctgctgcttggtttcaacacctttgatttcattaaagtg
ttgcggcagcacaggatgatgattttatactgtaccttgctggccagtgcacaaagtgaa
gctgaaaaggaaaggattatgggaaagatggaagctgacccagagctatccaagttcctc
taccagcttcatgaaaccgagaaggaggatctgatccgagaggaaaggtcccggagagag
cgagtgcgtcagtctcgaatggacacagatctggaaaccatggatctcgaccagggtgga
gaggcactggctccacggcaggttctggacttggaggacctggtttttacccaagggagc
cactttatggccaataaacgctgtcagcttcctgatggatccttccgtcgccagcgtaag
ggctatgaagaggtgcatgtgcctgctctgaagcccaagccctttggctcagaagaacaa
ctgcttccagtggaaaagctgccaaagtatgcccaggctgggtttgagggcttcaaaaca
ctgaatcggatccagagtaagctctaccgtgctgcccttgagacggatgagaatctgctg
ctgtgtgctcctactggtgctgggaagaccaacgtggccctgatgtgcatgctccgagag
attgggaaacacataaacatggacggcaccatcaatgtggatgacttcaagattatctac
attgcccccatgcgctccttggtgcaggagatggtgggcagctttggaaagcgcctggcc
acttatggcatcactgttgctgaactgactggggaccaccagctgtgcaaagaagagatc
agtgccactcagatcatcgtctgcacccccgagaagtgggacatcatcacccgcaagggt
ggtgagcgcacctacacccagctggtgcggctcatcattctggatgagattcatcttctc
cacgatgacagaggtcctgtcttagaagctttagtggccagggccatccgaaacattgag
atgacccaagaggatgtccgactcattggtctcagtgccaccctacccaactatgaagat
gtagccacctttctacgtgttgaccctgccaagggtctcttttactttgacaacagcttc
cgtccagtgcctctggaacagacatatgtgggtatcacagagaaaaaagctatcaagcgt
ttccagatcatgaatgaaatcgtctatgaaaaaatcatggaacatgctggaaaaaatcag
gtgctggtgtttgtccactcccggaaggagactggaaagacagccagggccatccgggac
atgtgcctagaaaaggacactctgggtctgtttctgagggagggctcagcctccacagaa
gtcctgcgaacagaagctgagcagtgcaagaacctagagctgaaggatcttctgccttat
ggctttgctattcatcacgcaggcatgaccagggttgaccgaacactcgtggaggatctt
tttgctgataaacatattcaggttttagtttccacagcaactctagcttggggtgtgaat
ctccctgcacatacagtcatcatcaaaggcacccaggtgtacagtccagagaaggggcgt
tggacagaactgggagcactggacattctgcagatgctgggacgtgccggaagaccccag
tatgacaccaagggtgaaggcatactcatcacatctcatggggagctacagtactacctg
tccctcctcaatcaacaacttcctattgaaagccagatggtttcaaagcttcctgacatg
ctcaatgcagaaatcgtgctaggaaatgtccagaatgccaaggatgcggtgaactggctg
ggctatgcctacctctatatccgaatgctgcgatccccaaccctctatggcatctctcat
gatgacctcaagggagatcccctgctggaccagcgccgactagatctggttcatacagct
gccctgatgctggacaagaacaatctggtcaagtacgacaagaagacgggcaacttccag
gtgacagaactgggccgtatagccagccactactacatcaccaatgatacagtgcagact
tacaaccagctgctgaagcccaccctgagtgagattgagcttttcagggtcttctcattg
tcctctgagttcaagaacatcacagtgagagaggaggagaagctggagctgcagaagttg
ctggagagggtgcctatccctgtaaaggagagcattgaggaacccagtgctaagatcaac
gttcttctgcaagccttcatctcacagctgaaattggagggctttgcactgatggctgac
atggtgtatgtcacacagtcggctggccggttgatgcgagcgatatttgaaattgtcctg
aaccgaggttgggcacagcttacagacaagaccctgaacctctgcaagatgatcgacaaa
cgcatgtggcagtccatgtgtcctctgcgccagttccggaaactccctgaggaagtagtg
aagaagattgagaagaagaatttcccctttgagcgtctgtacgacctgaatcataatgag
attggggagcttatccgcatgccaaagatggggaagaccatccacaaatatgtccatctg
tttcccaagttggagttgtcagtgcacctgcagcctatcacacgctccaccctgaaggtg
gagctgaccatcacgccagacttccagtgggatgaaaaggtgcatggttcatccgaggct
ttttggattctggtggaggatgtggacagcgaggtgattctgcaccatgagtattttctc
ctcaaggccaagtacgcccaggacgagcacctcattacattcttcgtgcctgtctttgaa
ccgctgccccctcagtacttcatccgagtggtgtctgaccgctggctctcttgtgagacc
cagctgcctgtctccttccggcacctgatcttgccggagaagtacccccctccaaccgaa
cttttggacctgcagcccttgcccgtgtctgctctgagaaacagtgcctttgagagtctt
taccaagataaatttcctttcttcaatcccatccagacccaggtgtttaacactgtatac
aacagtgacgacaacgtgtttgtgggggcccccacgggcagcgggaagactatttgtgca
gagtttgccatcctgcgaatgctgctgcagagctcggaggggcgctgtgtgtacatcacc
cccatggaggccctggcagagcaggtatacatggactggtacgagaagttccaggacagg
ctcaacaagaaggtggtactcctgacaggcgagaccagcacagacctgaagctgctgggc
aaagggaacattatcatcagcacccctgagaagtgggacatactttcccggcgatggaag
cagcgcaagaacgtgcagaacatcaacctcttcgtggtggatgaggtccaccttatcggg
ggcgagaatgggcctgtcttagaagtgatctgctcccgaatgcgctacatctcctcccag
attgagcggcccattcgcattgtggcactcagctcttcgctctccaatgccaaggatgtg
gcccactggctgggctgcagtgccacctccaccttcaacttccatcccaatgtgcgtccc
gtccccttggagctgcacatccagggcttcaacatcagccatacacaaacccgcctgctc
tccatggccaagcctgtgtaccatgctatcaccaagcactcgcccaagaagcctgtcatt
gtctttgtgccgtctcgcaagcagacccgcctcactgccattgacatcctcaccacctgt
gcagcagacatccaacggcagaggttcttgcactgcaccgagaaggatctgattccgtac
ctggagaagctaagtgacagcacgctcaaggaaacgctgctaaatggggtgggctacctg
catgaggggctcagccccatggagcgacgcctggtggagcagctcttcagctcaggggct
atccaggtggtggtggcttctcggagtctctgctggggcatgaacgtggctgcccacctg
gtaatcatcatggatacccagtactacaatggcaagatccacgcctatgtggattacccc
atctatgacgtgcttcagatggtgggccacgccaaccgccctttgcaggacgatgagggg
cgctgtgtcatcatgtgtcagggctccaagaaggatttcttcaagaagttcttatatgag
ccattgccagtagaatctcacctggaccactgtatgcatgaccacttcaatgctgagatc
gtcaccaagaccattgagaacaagcaggatgctgtggactacctcacctggacctttctg
taccgccgcatgacacagaaccccaattactacaacctgcagggcatctcccatcgtcac
ttgtcggaccacttgtcagagctggtggagcagaccctgagtgacctggagcagtccaag
tgcatcagcatcgaggacgagatggacgtggcgcctctgaacctaggcatgatcgccgcc
tactattacatcaactacaccaccattgagctcttcagcatgtccctcaatgccaagacc
aaggtgcgagggcttatcgagatcatctccaatgcagcagagtatgagaacattcccatc
cggcaccatgaagacaatctcctgaggcagttggctcagaaggtcccccacaagctgaat
aaccctaagttcaatgatccgcacgtcaagaccaacctgctcctgcaggctcacttgtct
cgcatgcagctgagtgctgagttgcagtcagatacggaggaaatccttagtaaggcaatc
cggctcatccaggcctgcgtggatgtcctttccagcaatgggtggctcagccctgctctg
gcagctatggaactggcccagatggtcacccaagccatgtggtccaaggactcatacctg
aagcagctgccacacttcacctctgagcatatcaaacgttgcacagacaagggagtggag
agtgttttcgacatcatggagatggaggatgaagaacggaacgcgttgcttcagctgact
gacagccagattgcagatgtggctcgcttttgtaaccgctaccctaatatcgaactatct
tatgaggtggtagataaggacagcatccgcagtggcgggccagttgtggtgctggtgcag
ctggagcgagaggaggaagtcacaggccctgtcattgcgcctctcttcccgcagaaacgt
gaagagggctggtgggtggtgattggagatgccaagtccaatagcctcatctccatcaag
aggctgaccttgcagcagaaggccaaggtgaagttggactttgtggccccagccactggt
gcccacaactacactctgtacttcatgagtgacgcttacatgggatgtgaccaggagtac
aaattcagcgtggatgtgaaagaagctgagacagacagtgattcagattga

DBGET integrated database retrieval system