KEGG   Homo sapiens (human): 23025Help
Entry
23025             CDS       T01001                                 

Gene name
UNC13A, Munc13-1
Definition
unc-13 homolog A (C. elegans)
Orthology
K15293  
protein unc-13
Organism
hsa  Homo sapiens (human)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    23025 (UNC13A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.11
AA seq 1703 aa AA seqDB search
MSLLCVGVKKAKFDGAQEKFNTYVTLKVQNVKSTTIAVRGSQPSWEQDFMFEINRLDLGL
TVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQVIMADSEICGTKDPTFHR
ILLDTRFELPLDIPEEEARYWAKKLEQLNAMRDQDEYSFQDEQDKPLPVPSNQCCNWNYF
GWGEQHNDDPDSAVDDRDSDYRSETSNSIPPPYYTTSQPNASVHQYSVRPPPLGSRESYS
DSMHSYEEFSEPQALSPTGSSRYASSGELSQGSSQLSEDFDPDEHSLQGSDMEDERDRDS
YHSCHSSVSYHKDSPRWDQDEEELEEDLEDFLEEEELPEDEEELEEEEEEVPDDLGSYAQ
REDVAVAEPKDFKRISLPPAAPGKEDKAPVAPTEAPDMAKVAPKPATPDKVPAAEQIPEA
EPPKDEESFRPREDEEGQEGQDSMSRAKANWLRAFNKVRMQLQEARGEGEMSKSLWFKGG
PGGGLIIIDSMPDIRKRKPIPLVSDLAMSLVQSRKAGITSALASSTLNNEELKNHVYKKT
LQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLN
ADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEIFAVTKTAHTQQM
KAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLN
PVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEVRTLSGEMD
VWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHFVTDVQNNGVVK
IPDAKGDDAWKVYYDETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTL
LANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSP
ERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYS
REYQTDPAKKGEVLPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVG
KISAEVMWNLFAQDMKYAMEEHDKHRLCKSADYMNLHFKVKWLYNEYVTELPAFKDRVPE
YPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLNQSF
EIIKKLECPDPQIVGHYMRRFAKTISNVLLQYADIISKDFASYCSKEKEKVPCILMNNTQ
QLRVQLEKMFEAMGGKELDAEASDILKELQVKLNNVLDELSRVFATSFQPHIEECVKQMG
DILSQVKGTGNVPASACSSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVLKRVLKELWK
LVMNTMEKTIVLPPLTDQTMIGNLLRKHGKGLEKGRVKLPSHSDGTQMIFNAAKELGQLS
KLKDHMVREEAKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSL
YTQATDLLIKTFVQTQSAQGLGVEDPVGEVSVHVELFTHPGTGEHKVTVKVVAANDLKWQ
TSGIFRPFIEVNIIGPQLSDKKRKFATKSKNNSWAPKYNESFQFTLSADAGPECYELQVC
VKDYCFAREDRTVGLAVLQLRELAQRGSAACWLPLGRRIHMDDTGLTVLRILSQRSNDEV
AKEFVKLKSDTRSAEEGGAAPAP
NT seq 5112 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgctttgcgttggagtcaaaaaagccaagtttgatggtgcccaagagaaattc
aacacgtacgtgaccctgaaagtgcagaatgtcaagagcacgaccatcgcggtgcggggc
agccagcccagctgggagcaggatttcatgttcgagattaaccgtctggatttgggactg
acggtggaggtgtggaataagggtctcatctgggacacaatggtgggcactgtgtggatc
ccactgaggaccatccgccagtccaatgaggagggccctggagagtggctgacgctggac
tcccaggtcatcatggcagacagtgagatctgtggcaccaaggaccccaccttccaccgc
atcctcctggacacgcgctttgagctacccttagacattcctgaagaggaggctcgctac
tgggccaagaagctggagcagctcaatgctatgcgggaccaggatgaatattcgttccaa
gatgagcaagacaagcctctgcctgtccccagcaaccagtgctgcaactggaattatttt
ggctggggtgagcagcacaacgatgaccccgacagtgcagtggatgatcgtgacagtgac
taccgcagtgaaacgagcaacagcatcccgccgccctattatactacgtcacaacccaac
gcctcagtccaccaatattctgttcgcccaccacccctgggctcccgggagtcctacagt
gactccatgcacagttacgaggagttctctgagccacaagccctcagccccacgggtagc
agccgctatgcctcttccggggagctgagccagggaagctctcagctgagcgaggacttc
gaccctgacgagcacagcctgcagggctccgacatggaggatgagcgggaccgggactcc
taccactcctgccacagctcggtcagctaccacaaagactcgcctcgctgggaccaggat
gaggaagagctggaggaggacctggaggacttcctggaggaggaggagctgcctgaagat
gaggaggagctggaggaggaggaggaggaggtgcctgacgatttgggcagctatgcccag
cgtgaagacgtagctgtggctgagcccaaagacttcaaacgcatcagcctcccgccagct
gccccagggaaggaggacaaggccccagtggcacccaccgaggcccccgacatggccaag
gtggcccccaagccagccacgcccgacaaggtgcctgcagctgagcagatccctgaggct
gagccacccaaggacgaggagagtttcaggccgagagaggatgaggaaggccaggagggg
caggactccatgtccagggccaaggccaactggctgcgtgccttcaacaaggtgcggatg
cagctgcaggaggcccggggagaaggagagatgtctaaatccctatggttcaaaggcggc
ccagggggcggtctcatcatcatcgacagcatgccagacatccgcaagaggaaacctatc
ccactcgtgagcgacttggccatgtccctggtccagtccaggaaagcgggcatcacctcg
gccttggcctccagcacgttgaacaacgaggagctgaaaaaccacgtttacaagaagacc
ctgcaagccttaatctaccccatctcgtgcacgacgccacacaacttcgaagtgtggacg
gccaccacgcccacctactgctacgagtgcgaggggctgctgtggggcatcgcgaggcag
ggcatgcgctgcaccgagtgcggtgtcaagtgccacgagaagtgccaggacctgctcaac
gccgactgcctgcagcgggctgcggagaagagctccaagcacggggcggaggaccggaca
cagaacatcatcatggtgctcaaggaccgcatgaagatccgggagcgcaacaagcccgag
atcttcgagctcatccaggagatcttcgcggtgaccaagacggcgcacacgcagcagatg
aaggcggtcaagcagagcgtgctggacggcacgtccaagtggtccgccaagatcagcatc
accgtggtctgcgcccagggcttgcaggcaaaggacaagacaggatccagtgacccctat
gtcaccgtccaggtcgggaagaccaagaaacggacaaaaaccatctatgggaacctcaac
ccggtgtgggaggagaatttccactttgaatgtcacaattcctccgaccgcatcaaggtg
cgcgtctgggacgaggatgacgacatcaaatcccgcgtgaaacagaggttcaagagggaa
tctgacgatttcctggggcagacgatcattgaggtgcggacgctcagcggcgagatggac
gtgtggtacaacctggacaagcgaactgacaaatctgccgtgtcgggtgccatccggctc
cacatcagtgtggagatcaaaggcgaggagaaggtggccccgtaccatgtccagtacacc
tgtctgcatgagaacctgttccacttcgtgaccgacgtgcagaacaatggggtcgtgaag
atcccagatgccaagggtgacgatgcctggaaggtttactacgatgagacagcccaggag
attgtggacgagtttgccatgcgctacggcgtcgagtccatctaccaagccatgacccac
tttgcctgcctctcctccaagtatatgtgcccaggggtgcctgccgtcatgagcaccctg
ctcgccaacatcaatgcctactacgcacacaccaccgcctccaccaacgtgtctgcctcc
gaccgcttcgccgcctccaactttgggaaagagcgcttcgtgaaactcctggaccagctg
cataactccctgcggattgacctctccatgtaccggaataacttcccagccagcagcccg
gagagactccaggacctcaaatccactgtggaccttctcaccagcatcaccttctttcgg
atgaaggtacaagaactccagagcccgccccgagccagccaggtggtaaaggactgtgtg
aaagcctgccttaattctacctacgagtacatcttcaataactgccatgaactgtacagc
cgggagtaccagacagacccggccaagaagggggaagttctcccagaggaacaggggccc
agcatcaagaacctcgacttctggtccaagctgattaccctcatagtgtccatcattgag
gaagacaagaattcctacactccctgcctcaaccagtttccccaggagctgaatgtgggt
aaaatcagcgctgaagtgatgtggaatctgtttgcccaagacatgaagtacgccatggag
gagcacgacaagcatcgtctatgcaagagtgccgactacatgaacctccacttcaaggtg
aaatggctctacaatgagtatgtgacggaacttcccgccttcaaggaccgcgtgcctgag
taccctgcatggtttgaacccttcgtcatccagtggctggatgagaatgaggaggtgtcc
cgggatttcctgcacggtgccctggagcgagacaagaaggatgggttccagcagacctca
gagcatgccctattctcctgctccgtggtggatgttttctcccaactcaaccagagcttt
gaaatcatcaagaaactcgagtgtcccgaccctcagatcgtggggcactacatgaggcgc
tttgccaagaccatcagtaatgtgctcctccagtatgcagacatcatctccaaggacttt
gcctcctactgctccaaggagaaggagaaagtgccctgcattctcatgaataacactcaa
cagctacgagttcagctggagaagatgttcgaagccatgggaggaaaggagctggatgct
gaagccagtgacatcctgaaggagcttcaggtgaaactcaataacgtcttggatgagctc
agccgggtgtttgctaccagcttccagccgcacattgaagagtgtgtcaaacagatgggt
gacatccttagccaggttaagggcacaggcaatgtgccagccagtgcctgcagcagcgtg
gcccaggacgcggacaatgtgttgcagcccatcatggacctgctggacagcaacctgacc
ctctttgccaaaatctgtgagaagactgtgctgaagcgagtgctgaaggagctgtggaag
ctggttatgaacaccatggagaaaaccatcgtcctgccgcccctcactgaccagacgatg
atcgggaacctcttgagaaaacatggcaagggattagaaaagggcagggtgaaattgcca
agccactcagacggaacccagatgatcttcaatgcagccaaggagctgggtcagctgtcc
aaactcaaggatcacatggtacgagaagaagccaagagcttgaccccaaagcagtgcgcg
gttgttgagttggccctggacaccatcaagcaatatttccacgcgggtggcgtgggcctc
aagaagaccttcctggagaagagcccggacctgcaatccttgcgctatgccctgtcgctc
tacacgcaggccaccgacctgctaatcaagacctttgtacagacgcaatcggcccagggc
ttgggtgtagaagaccctgtgggtgaagtctctgtccatgttgagctgttcactcatcca
ggaactggggaacacaaggtcacagtgaaagtggtggctgccaatgacctcaagtggcag
acttctggcatcttccggccgttcatcgaggtcaacatcattgggccccagctcagcgac
aagaaacgcaagtttgcgaccaaatccaagaacaatagctgggctcccaagtacaatgag
agcttccagttcacgctgagcgccgacgcgggtcccgagtgctatgagctgcaggtgtgc
gtcaaggactactgcttcgcgcgcgaggaccgcacggtggggctggccgtgctgcagctg
cgtgagctggcccagcgcgggagcgccgcctgctggctgccgctcggccgccgcatccac
atggacgacacgggcctcacggtgctgcgaatcctctcgcagcgcagcaacgacgaggtg
gccaaggagttcgtgaagctcaagtcggacacgcgctccgccgaggagggcggtgccgcg
cctgcgccttag

DBGET integrated database retrieval system