KEGG   Homo sapiens (human): 23031Help
Entry
23031             CDS       T01001                                 

Gene name
MAST3
Definition
(RefSeq) microtubule associated serine/threonine kinase 3 (EC:2.7.11.1)
  KO
K08789  
microtubule-associated serine/threonine kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     23031 (MAST3)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  MAST family [OT]
   23031 (MAST3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.11
AA seq 1309 aa AA seqDB search
MDESSLLRRRGLQKELSLPRRGRGCRSGNRKSLVVGTPSPTLSRPLSPLSVPTAGSSPLD
SPRNFSAASALNFPFARRADGRRWSLASLPSSGYGTNTPSSTLSSSSSSRERLHQLPFQP
TPDELHFLSKHFRSSENVLDEEGGRSPRLRPRSRSLSPGRATGTFDNEIVMMNHVYRERF
PKATAQMEGRLQEFLTAYAPGARLALADGVLGFIHHQIVELARDCLAKSGENLVTSRYFL
EMQEKLERLLQDAHERSDSEEVSFIVQLVRKLLIIISRPARLLECLEFDPEEFYHLLEAA
EGHAREGQGIKTDLPQYIIGQLGLAKDPLEEMVPLSHLEEEQPPAPESPESRALVGQSRR
KPCESDFETIKLISNGAYGAVYLVRHRDTRQRFAIKKINKQNLILRNQIQQVFVERDILT
FAENPFVVSMFCSFETRRHLCMVMEYVEGGDCATLLKNMGPLPVDMARLYFAETVLALEY
LHNYGIVHRDLKPDNLLITSLGHIKLTDFGLSKIGLMSMATNLYEGHIEKDAREFIDKQV
CGTPEYIAPEVIFRQGYGKPVDWWAMGVVLYEFLVGCVPFFGDTPEELFGQVVSDEIMWP
EGDEALPADAQDLITRLLRQSPLDRLGTGGTHEVKQHPFFLALDWAGLLRHKAEFVPQLE
AEDDTSYFDTRSERYRHLGSEDDETNDEESSTEIPQFSSCSHRFSKVYSSSEFLAVQPTP
TFAERSFSEDREEGWERSEVDYGRRLSADIRLRSWTSSGSSCQSSSSQPERGPSPSLLNT
ISLDTMPKFAFSSEDEGVGPGPAGPKRPVFILGEPDPPPAATPVMPKPSSLSADTAALSH
ARLRSNSIGARHSTPRPLDAGRGRRLGGPRDPAPEKSRASSSGGSGGGSGGRVPKSASVS
ALSLIITADDGSGGPLMSPLSPRSLSSNPSSRDSSPSRDPSPVCGSLRPPIVIHSSGKKY
GFSLRAIRVYMGDSDVYTVHHVVWSVEDGSPAQEAGLRAGDLITHINGESVLGLVHMDVV
ELLLKSGNKISLRTTALENTSIKVGPARKNVAKGRMARRSKRSRRRETQDRRKSLFKKIS
KQTSVLHTSRSFSSGLHHSLSSSESLPGSPTHSLSPSPTTPCRSPAPDVPADTTASPPSA
SPSSSSPASPAAAGHTRPSSLHGLAAKLGPPRPKTGRRKSTSSIPPSPLACPPISAPPPR
SPSPLPGHPPAPARSPRLRRGQSADKLGTGERLDGEAGRRTRGPEAELVVMRRLHLSERR
DSFKKQEAVQEVSFDEPQEEATGLPTSVPQIAVEGEEAVPVALGPTGRD
NT seq 3930 nt NT seq  +upstreamnt  +downstreamnt
atggacgagtcgagcctcctgcggcgccgcgggctccagaaggagctgagcctgccacgc
cgaggacgtggctgccgcagcgggaaccgcaagagcttggtggtaggaacgccctccccg
accctctcccggcccctgtcgccattgtcggtcccaacggcaggcagcagccccttggat
agtcctcggaatttctcggctgcctctgccctaaatttcccctttgcccggagggcagac
ggcagaagatggtccctcgcgtctctcccatcttccggctatggaaccaacacacccagc
tccaccctctcgtcaagctcatcctcccgggaacgtctccaccagcttcccttccagccg
acgccggacgagctgcacttcctgtccaagcacttccgcagctcagagaatgtgcttgat
gaggaaggcggccggtcaccccgcctccgaccccgctctcgcagtctcagcccgggccgt
gcaacggggaccttcgacaatgagattgtcatgatgaatcacgtgtaccgggagaggttc
cccaaggccacagcacagatggagggccgtctgcaggagttcctgacggcctacgcgccc
ggcgcccggctggcgctggctgatggcgtcttgggcttcatccaccaccagatcgtcgag
ctggcccgagactgcttggccaagtctggcgagaacctcgtcacctcccgctacttccta
gagatgcaggagaagctggagcggcttctgcaggatgcccatgagcgttcggacagtgag
gaggtcagcttcatcgtccagcttgtccggaaactgctgatcatcatctcacggccagct
cggctgctggagtgtctggagtttgaccctgaggaattttaccacctgctggaggcggct
gagggccatgcgcgggagggccaaggcattaagactgaccttccacagtacatcattggg
cagctgggcctggccaaggaccccctggaggagatggtgccactgagtcacctcgaagaa
gaacagcccccagcacctgagtccccagagagccgcgccctggtcggccagtcacggagg
aagccatgcgaaagcgactttgagaccatcaaactcattagcaacggagcctatggggcc
gtctacctggtgcggcaccgtgacacacggcagcgctttgccatcaagaagatcaacaaa
cagaacttgatcctgcgtaaccagatccagcaggtctttgtggagcgtgacattctcacc
tttgccgagaacccctttgtggtcagcatgttctgctcctttgagacccggcgccaccta
tgtatggtcatggaatacgtggaaggcggcgactgcgccacgctcctgaagaacatgggc
ccgctgcccgtggacatggcccgcctgtacttcgccgagacggtgttggcgctggagtac
ctgcataactatggcatcgtgcaccgtgacctcaaaccagacaatctgctcatcacctcg
cttggccacatcaagctcacggacttcggcctgtccaagatcggcctcatgagcatggcc
accaacctctatgagggccacatcgagaaggacgcccgagagttcatcgacaagcaggtg
tgtgggacgccggagtacatagcccccgaggtgatcttccgccagggctatgggaagcca
gtggactggtgggccatgggcgtcgtcctctatgagtttctggtgggctgcgtgcctttc
tttggagatacccccgaggaactcttcggtcaggtggtcagcgatgagatcatgtggcca
gagggagatgaggcccttccagcagacgcccaggacctcatcaccaggttgctccggcag
agcccgctggaccgtctgggcactggtggcacccacgaagtgaagcagcacccctttttc
ctggccctggactgggcagggcttctccgacacaaagccgagttcgtgccccagctcgaa
gctgaggatgataccagctactttgacacacgttcggaacgttaccgccatctgggctcc
gaggacgacgagaccaatgatgaagaatcgtccacagagatcccccagttctcctcctgc
tcccaccggttcagcaaggtctacagcagctctgagttcctggccgtccagcccactcct
accttcgctgaaaggagcttcagtgaagaccgggaggaggggtgggagcgcagcgaagtg
gactatggccgccggctgagtgctgacatccggctgaggtcctggacatcctctggatcc
tcctgtcagtcatcttcgtcccagcccgagcggggtcccagcccatctctcctgaatacc
atcagcctggacacaatgcccaagtttgccttctcatcagaggatgagggggtaggccca
ggccctgcaggccccaagaggcccgtcttcattctaggggagcctgaccccccaccagcg
gccaccccagtgatgcccaagccctcgagcctttctgccgacacagctgctctcagccac
gcccgcctacggagcaatagcatcggcgcccgacactccacaccaaggcctctggatgcc
ggccggggccgccgccttgggggcccaagagacccagcccctgagaagtccagagcctcc
tccagcggtggcagtggtggcggcagtgggggccgcgtgcccaagtcagcctctgtctct
gccctgtccctcatcatcacggcagatgatggcagcggcggccccctcatgagccccctt
tccccgcgctctctgtcctcgaacccgtcgtcccgtgactcttcgccgagccgagacccg
tcccccgtgtgtggcagcctgcggccccccatcgttatccacagctctggcaagaagtac
ggcttcagcctgcgggcgatccgcgtctacatgggtgatagcgacgtctacactgtgcac
cacgtcgtctggagtgtggaggacggaagccccgcccaggaggcgggcctgcgggctggg
gacctcatcacccacatcaacggggagtcagtgctggggctggtgcacatggacgtcgtg
gagctgctgctgaagagcggcaacaagatatccctgcggaccacagccctggagaacacc
tccatcaaggtgggccccgcccggaagaatgtggccaagggccgcatggcacgcaggagc
aagaggagccgtcggcgggagacccaggatcggcggaagtcacttttcaagaagatctcc
aagcagacctccgtgctgcacaccagccgcagcttctcctccggactccaccactcactg
tcatccagtgagagcctccccggctcgcccacccacagcctctcccccagccccaccact
ccctgccgaagcccagcccctgatgtcccagcagataccactgcatccccacccagcgca
tccccgagctccagcagccccgcctccccagctgctgctggccacacccgccccagctcc
ctgcacggcctggctgccaagcttgggccaccccgccccaagactggccgccgcaagtcc
accagcagcatcccgccctccccgctggcctgcccgcccatctccgcgcccccaccccgc
tcgccctcgcccctgcccgggcacccgcccgcacctgcccgatccccgcggctgcgccgg
ggccagtcagctgacaagctgggcacaggggagcggctggatggggaggcggggcggcgc
actcgtgggccagaggccgagctcgtggtcatgcggcggctgcacctgtccgagcgccga
gactccttcaagaagcaggaggccgtgcaggaggttagcttcgatgagccgcaggaggag
gccactgggctgcccacctcagtgccacagatcgccgtggagggcgaggaagccgtgcca
gtagctctcgggcccaccggaagagactga

DBGET integrated database retrieval system