KEGG   Homo sapiens (human): 23032Help
Entry
23032             CDS       T01001                                 

Gene name
USP33, VDU1
Definition
ubiquitin specific peptidase 33 (EC:3.4.19.12)
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     23032 (USP33)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   23032 (USP33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p31.1
AA seq 942 aa AA seqDB search
MTGSNSHITILTLKVLPHFESLGKQEKIPNKMSAFRNHCPHLDSVGEITKEDLIQKSLGT
CQDCKVQGPNLWACLENRCSYVGCGESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKE
VFLDRKLGTQPSLPHVRQPHQIQENSVQDFKIPSNTTLKTPLVAVFDDLDIEADEEDELR
ARGLTGLKNIGNTCYMNAALQALSNCPPLTQFFLDCGGLARTDKKPAICKSYLKLMTELW
HKSRPGSVVPTTLFQGIKTVNPTFRGYSQQDAQEFLRCLMDLLHEELKEQVMEVEEDPQT
ITTEETMEEDKSQSDVDFQSCESCSNSDRAENENGSRCFSEDNNETTMLIQDDENNSEMS
KDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETVKVQIHSRASEYITDVHSNDL
STPQILPSNEGVNPRLSASPPKSGNLWPGLAPPHKKAQSASPKRKKQHKKYRSVISDIFD
GTIISSVQCLTCDRVSVTLETFQDLSLPIPGKEDLAKLHSSSHPTSIVKAGSCGEAYAPQ
GWIAFFMEYVKRFVVSCVPSWFWGPVVTLQDCLAAFFARDELKGDNMYSCEKCKKLRNGV
KFCKVQNFPEILCIHLKRFRHELMFSTKISTHVSFPLEGLDLQPFLAKDSPAQIVTYDLL
SVICHHGTASSGHYIAYCRNNLNNLWYEFDDQSVTEVSESTVQNAEAYVLFYRKSSEEAQ
KERRRISNLLNIMEPSLLQFYISRQWLNKFKTFAEPGPISNNDFLCIHGGVPPRKAGYIE
DLVLMLPQNIWDNLYSRYGGGPAVNHLYICHTCQIEAEKIEKRRKTELEIFIRLNRAFQK
EDSPATFYCISMQWFREWESFVKGKDGDPPGPIDNTKIAVTKCGNVMLRQGADSGQISEE
TWNFLQSIYGGGPEVILRPPVVHVDPDILQAEEKIEVETRSL
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgacaggatcaaattcacacataacgatattaaccttaaaggtgttacctcattttgaa
agtcttgggaaacaggaaaaaattcctaacaaaatgtcagcttttcgaaatcattgtcca
catttggattcagttggtgaaataacaaaagaagatttgatacaaaaatcccttggtact
tgtcaggattgtaaagtccaaggaccaaatctttgggcatgtctggagaatagatgttca
tatgttggctgtggtgaatcacaagtagatcacagcaccatacattctcaggagacaaag
cattatctaactgtgaaccttaccactcttcgagtatggtgttatgcttgcagcaaagaa
gtatttttggataggaaattaggaactcagccttcattgcctcatgtaagacaacctcac
caaatacaagaaaacagtgtccaggattttaaaatacccagtaatacaacattaaaaact
cctctggttgccgtatttgatgatctggatatagaagcggatgaagaagatgaacttagg
gccagaggtcttacaggtttgaaaaatattggaaatacttgttacatgaatgcagctttg
caggctctttctaattgcccacctttgacacagttttttcttgattgtggaggactagct
cgaacagataagaaacctgccatttgtaaaagttatctcaaactaatgacagagctgtgg
cataaaagcaggccaggatctgttgtgcctactactctgtttcaaggaattaaaactgta
aatccaacatttcgggggtattctcagcaggatgctcaagaattccttcgatgtttaatg
gatttgcttcatgaagaattgaaagagcaagtcatggaagtagaagaagatccgcaaacc
ataaccactgaggagacaatggaagaagacaagagccagtcggatgtagattttcagtct
tgtgaatcttgtagcaacagtgatagagcagaaaatgaaaatggctctagatgcttttct
gaagataataatgaaacaacaatgttaattcaggatgatgaaaacaattcagaaatgtca
aaggattggcaaaaagagaagatgtgcaataagattaataaagtaaattctgaaggcgaa
tttgataaagatagagactctatatctgaaacagtcgacttaaacaaccaggaaactgtc
aaagtgcaaatacacagcagagcttcagaatatatcactgatgtccattcgaatgacctg
tctacaccacagatccttccatcaaatgaaggtgttaatccacgtttatcggcaagccct
cctaaatcaggcaatttgtggccaggattggcaccaccacacaaaaaagctcagtctgca
tctccaaagagaaaaaaacagcacaagaaatacagaagtgttatttcagacatatttgat
ggaacaatcattagttcagtgcagtgtctgacttgtgacagggtgtctgtaaccctcgag
acctttcaagatctgtccttgccaattcctggcaaggaagaccttgctaagctgcattca
tcaagtcatccaacttctatagtcaaagcaggatcatgtggcgaagcatatgctccacaa
gggtggatagcttttttcatggaatatgtgaagaggtttgttgtctcatgtgtccctagc
tggttttggggtccagtagtaaccttgcaagattgtcttgctgccttctttgccagagat
gaactaaaaggtgacaatatgtacagttgtgaaaaatgcaaaaagttgagaaatggagtg
aagttttgtaaagtacaaaactttcctgagattttgtgcatccaccttaaaagattcaga
catgaactaatgttttccaccaaaatcagtacccatgtttcatttccgctagaaggcttg
gatcttcagccatttcttgctaaggatagtccagctcaaattgtgacatatgatcttctg
tcagtcatttgccatcatggaactgcaagtagtggacactatatagcctactgccgaaac
aatctaaataatctctggtatgaatttgatgatcagagtgtcactgaagtttcagaatct
actgtacaaaatgcagaagcttacgttcttttctataggaagagcagcgaagaggcacaa
aaagagaggagaaggatatcaaatttattgaacataatggaaccaagcctccttcagttt
tatatttctcgacagtggcttaataaatttaagacctttgccgaacctggccctatttca
aataatgactttctttgtattcatggaggtgttcctccaagaaaagctggttatattgaa
gacctggttttgatgctgcctcagaacatttgggataacctatatagcaggtatggtgga
ggaccagctgtcaaccatctgtacatttgtcatacttgccaaattgaggcggagaaaatt
gaaaaaagaagaaaaactgaattggaaatttttattcggcttaacagagcgttccaaaaa
gaggactctccagctactttttattgcatcagtatgcagtggtttagagaatgggaaagt
tttgtgaagggtaaagatggagatcctccaggtcctattgacaatactaagattgcagtc
actaaatgtggtaatgtgatgcttaggcaaggagcagattctggccagatttctgaagaa
acatggaattttctgcagtctatttatggtggagggcctgaagttatcctgcgacctccg
gttgttcatgttgatccagatatacttcaagcagaagaaaaaattgaagtagaaactcgg
tctttgtaa

DBGET integrated database retrieval system