KEGG   Homo sapiens (human): 23032Help
Entry
23032             CDS       T01001                                 

Gene name
USP33, VDU1
Definition
(RefSeq) ubiquitin specific peptidase 33
  KO
K11848  ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     23032 (USP33)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   23032 (USP33)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    23032 (USP33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 DUSP zf-UBP
Motif
Other DBs
NCBI-GeneID: 23032
NCBI-ProteinID: NP_055832
OMIM: 615146
HGNC: 20059
Ensembl: ENSG00000077254
Vega: OTTHUMG00000009651
Pharos: Q8TEY7(Tbio)
UniProt: Q8TEY7
Structure
PDB: 

Jmol
Position
1p31.1
AA seq 942 aa AA seqDB search
MTGSNSHITILTLKVLPHFESLGKQEKIPNKMSAFRNHCPHLDSVGEITKEDLIQKSLGT
CQDCKVQGPNLWACLENRCSYVGCGESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKE
VFLDRKLGTQPSLPHVRQPHQIQENSVQDFKIPSNTTLKTPLVAVFDDLDIEADEEDELR
ARGLTGLKNIGNTCYMNAALQALSNCPPLTQFFLDCGGLARTDKKPAICKSYLKLMTELW
HKSRPGSVVPTTLFQGIKTVNPTFRGYSQQDAQEFLRCLMDLLHEELKEQVMEVEEDPQT
ITTEETMEEDKSQSDVDFQSCESCSNSDRAENENGSRCFSEDNNETTMLIQDDENNSEMS
KDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETVKVQIHSRASEYITDVHSNDL
STPQILPSNEGVNPRLSASPPKSGNLWPGLAPPHKKAQSASPKRKKQHKKYRSVISDIFD
GTIISSVQCLTCDRVSVTLETFQDLSLPIPGKEDLAKLHSSSHPTSIVKAGSCGEAYAPQ
GWIAFFMEYVKRFVVSCVPSWFWGPVVTLQDCLAAFFARDELKGDNMYSCEKCKKLRNGV
KFCKVQNFPEILCIHLKRFRHELMFSTKISTHVSFPLEGLDLQPFLAKDSPAQIVTYDLL
SVICHHGTASSGHYIAYCRNNLNNLWYEFDDQSVTEVSESTVQNAEAYVLFYRKSSEEAQ
KERRRISNLLNIMEPSLLQFYISRQWLNKFKTFAEPGPISNNDFLCIHGGVPPRKAGYIE
DLVLMLPQNIWDNLYSRYGGGPAVNHLYICHTCQIEAEKIEKRRKTELEIFIRLNRAFQK
EDSPATFYCISMQWFREWESFVKGKDGDPPGPIDNTKIAVTKCGNVMLRQGADSGQISEE
TWNFLQSIYGGGPEVILRPPVVHVDPDILQAEEKIEVETRSL
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgacaggatcaaattcacacataacgatattaaccttaaaggtgttacctcattttgaa
agtcttgggaaacaggaaaaaattcctaacaaaatgtcagcttttcgaaatcattgtcca
catttggattcagttggtgaaataacaaaagaagatttgatacaaaaatcccttggtact
tgtcaggattgtaaagtccaaggaccaaatctttgggcatgtctggagaatagatgttca
tatgttggctgtggtgaatcacaagtagatcacagcaccatacattctcaggagacaaag
cattatctaactgtgaaccttaccactcttcgagtatggtgttatgcttgcagcaaagaa
gtatttttggataggaaattaggaactcagccttcattgcctcatgtaagacaacctcac
caaatacaagaaaacagtgtccaggattttaaaatacccagtaatacaacattaaaaact
cctctggttgccgtatttgatgatctggatatagaagcggatgaagaagatgaacttagg
gccagaggtcttacaggtttgaaaaatattggaaatacttgttacatgaatgcagctttg
caggctctttctaattgcccacctttgacacagttttttcttgattgtggaggactagct
cgaacagataagaaacctgccatttgtaaaagttatctcaaactaatgacagagctgtgg
cataaaagcaggccaggatctgttgtgcctactactctgtttcaaggaattaaaactgta
aatccaacatttcgggggtattctcagcaggatgctcaagaattccttcgatgtttaatg
gatttgcttcatgaagaattgaaagagcaagtcatggaagtagaagaagatccgcaaacc
ataaccactgaggagacaatggaagaagacaagagccagtcggatgtagattttcagtct
tgtgaatcttgtagcaacagtgatagagcagaaaatgaaaatggctctagatgcttttct
gaagataataatgaaacaacaatgttaattcaggatgatgaaaacaattcagaaatgtca
aaggattggcaaaaagagaagatgtgcaataagattaataaagtaaattctgaaggcgaa
tttgataaagatagagactctatatctgaaacagtcgacttaaacaaccaggaaactgtc
aaagtgcaaatacacagcagagcttcagaatatatcactgatgtccattcgaatgacctg
tctacaccacagatccttccatcaaatgaaggtgttaatccacgtttatcggcaagccct
cctaaatcaggcaatttgtggccaggattggcaccaccacacaaaaaagctcagtctgca
tctccaaagagaaaaaaacagcacaagaaatacagaagtgttatttcagacatatttgat
ggaacaatcattagttcagtgcagtgtctgacttgtgacagggtgtctgtaaccctcgag
acctttcaagatctgtccttgccaattcctggcaaggaagaccttgctaagctgcattca
tcaagtcatccaacttctatagtcaaagcaggatcatgtggcgaagcatatgctccacaa
gggtggatagcttttttcatggaatatgtgaagaggtttgttgtctcatgtgtccctagc
tggttttggggtccagtagtaaccttgcaagattgtcttgctgccttctttgccagagat
gaactaaaaggtgacaatatgtacagttgtgaaaaatgcaaaaagttgagaaatggagtg
aagttttgtaaagtacaaaactttcctgagattttgtgcatccaccttaaaagattcaga
catgaactaatgttttccaccaaaatcagtacccatgtttcatttccgctagaaggcttg
gatcttcagccatttcttgctaaggatagtccagctcaaattgtgacatatgatcttctg
tcagtcatttgccatcatggaactgcaagtagtggacactatatagcctactgccgaaac
aatctaaataatctctggtatgaatttgatgatcagagtgtcactgaagtttcagaatct
actgtacaaaatgcagaagcttacgttcttttctataggaagagcagcgaagaggcacaa
aaagagaggagaaggatatcaaatttattgaacataatggaaccaagcctccttcagttt
tatatttctcgacagtggcttaataaatttaagacctttgccgaacctggccctatttca
aataatgactttctttgtattcatggaggtgttcctccaagaaaagctggttatattgaa
gacctggttttgatgctgcctcagaacatttgggataacctatatagcaggtatggtgga
ggaccagctgtcaaccatctgtacatttgtcatacttgccaaattgaggcggagaaaatt
gaaaaaagaagaaaaactgaattggaaatttttattcggcttaacagagcgttccaaaaa
gaggactctccagctactttttattgcatcagtatgcagtggtttagagaatgggaaagt
tttgtgaagggtaaagatggagatcctccaggtcctattgacaatactaagattgcagtc
actaaatgtggtaatgtgatgcttaggcaaggagcagattctggccagatttctgaagaa
acatggaattttctgcagtctatttatggtggagggcctgaagttatcctgcgacctccg
gttgttcatgttgatccagatatacttcaagcagaagaaaaaattgaagtagaaactcgg
tctttgtaa

DBGET integrated database retrieval system