KEGG   Homo sapiens (human): 23041Help
Entry
23041             CDS       T01001                                 

Gene name
MON2
Definition
(RefSeq) MON2 homolog, regulator of endosome-to-Golgi trafficking
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q14.1
AA seq 1717 aa AA seqDB search
MSGTSSPEAVKKLLENMQSDLRALSLECKKKFPPVKEAAESGIIKVKTIAARNTEILAAL
KENSSEVVQPFLMGCGTKEPKITQLCLAAIQRLMSHEVVSETAAGNIINMLWQLMENSLE
ELKLLQTVLVLLTTNTVVHDEALSKAIVLCFRLHFTKDNITNNTAAATVRQVVTVVFERM
VAEDERHRDIIEQPVLVQGNSNRRSVSTLKPCAKDAYMLFQDLCQLVNADAPYWLVGMTE
MTRTFGLELLESVLNDFPQVFLQHQEFSFLLKERVCPLVIKLFSPNIKFRQGSSTSSSPA
PVEKPYFPICMRLLRVVSVLIKQFYSLLVTECEIFLSLLVKFLDADKPQWLRAVAVESIH
RFCVQPQLLRSFCQSYDMKQHSTKVFRDIVNALGSFIQSLFLVPPTGNPATSNQAGNNNL
GGSVSAPANSGMVGIGGGVTLLPAFEYRGTWIPILTITVQGSAKATYLEMLDKVEPPTIP
EGYAMSVAFHCLLDLVRGITSMIEGELGELETECQTTTEEGSSPTQSTEQQDLQSTSDQM
DKEIVSRAVWEEMVNACWCGLLAALSLLLDASTDEAATENILKAELTMAALCGRLGLVTS
RDAFITAICKGSLPPHYALTVLNTTTAATLSNKSYSVQGQSVMMISPSSESHQQVVAVGQ
PLAVQPQGTVMLTSKNIQCMRTLLNLAHCHGAVLGTSWQLVLATLQHLVWILGLKPSSGG
ALKPGRAVEGPSTVLTTAVMTDLPVISNILSRLFESSQYLDDVSLHHLINALCSLSLEAM
DMAYGNNKEPSLFAVAKLLETGLVNMHRIEILWRPLTGHLLEVCQHPNSRMREWGAEALT
SLIKAGLTFNHDPPLSQNQRLQLLLLNPLKEMSNINHPDIRLKQLECVLQILQSQGDSLG
PGWPLVLGVMGAIRNDQGESLIRTAFQCLQLVVTDFLPTMPCTCLQIVVDVAGSFGLHNQ
ELNISLTSIGLLWNISDYFFQRGETIEKELNKEEAAQQKQAEEKGVVLNRPFHPAPPFDC
LWLCLYAKLGELCVDPRPAVRKSAGQTLFSTIGAHGTLLQHSTWHTVIWKVLFHLLDRVR
ESSTTADKEKIESGGGNILIHHSRDTAEKQWAETWVLTLAGVARIFNTRRYLLQPLGDFS
RAWDVLLDHIQSAALSKNNEVSLAALKSFQEILQIVSPVRDSDKPETPPVVNVPVPVLIG
PISGMSRPFVRTDSIGEKLGRYSSSEPPIVTDELEDLNLWWAAWNTWYRIGSESTKPPIT
FDKLTFIPSQPFLTALIQIFPALYQHIKTGFNMDDLQKLGVILHSAISVPISSDASPFIL
PSYTEAVLTSLQEAVLTALDVLQKAICVGPENMQIMYPAIFDQLLAFVEFSCKPPQYGQL
ETKHIANAKYNQIQLFAPAEWVALNYVPFAERSLEVVVDLYQKTACHKAVVNEKVLQNII
KTLRVPLSLKYSCPSESTWKLAVSSLLRVLSIGLPVARQHASSGKFDSMWPELANTFEDF
LFTKSIPPDNLSIQEFQRNENIDVEVVQLISNEILPYANFIPKEFVGQIMTMLNKGSIHS
QSSSFTEAEIDIRLREEFSKMCFETLLQFSFSNKVTTPQEGYISRMALSVLLKRSQDVLH
RYIEDERLSGKCPLPRQQVTEIIFVLKAVSTLIDSLKKTQPENVDGNTWAQVIALYPTLV
ECITCSSSEVCSALKEALVPFKDFMQPPASRVQNGES
NT seq 5154 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcaccagcagccccgaggcggtgaagaagctgctggagaatatgcagagcgac
ttgcgcgccttgtcactggagtgcaagaagaaattcccacctgtcaaagaggctgctgaa
tcaggaataataaaagttaaaacaattgctgcacgaaacactgaaattttggcagcactg
aaagagaacagctcagaggttgtacagccttttttaatgggttgtggaaccaaggaaccg
aagatcactcagctatgtttggctgctattcagagactcatgtcacatgaagtcgtgtct
gagactgcagctggaaatataattaacatgctttggcagctaatggagaatagtcttgaa
gaacttaagctacttcaaacagttcttgttcttttaacaaccaatacagtagttcatgat
gaggcactttctaaggcaatcgttctttgttttcgactacacttcacaaaagataatatt
acaaataatacagctgctgctacagtgcgacaagttgttactgttgtttttgagaggatg
gttgctgaagatgaacgacacagagatattatagaacaaccagtactggtacaaggaaat
agtaacagaagatctgtcagtaccctcaaaccttgtgctaaagatgcatatatgcttttc
caggatctttgtcagttggttaatgctgatgctccttattggctagtgggcatgacagaa
atgactcggacgtttggcctcgaattacttgagtcagtcctcaatgattttccgcaggtc
tttttacaacaccaagaatttagtttcctcctcaaagaaagggtatgtcctcttgtgata
aagctcttttctccaaatataaagttcagacaaggttccagcacctcatcttctccagca
ccagttgaaaaaccatattttcctatctgcatgcgtttgctgagagtagtatctgttctg
attaagcagttttacagtcttttggtaactgaatgtgagatatttctgtcacttctggtg
aaatttctggatgcagataaaccacagtggctacgagctgttgcggtggaatcaatacac
agattctgtgtgcagcctcaactattaaggtcattttgtcagtcctatgatatgaaacag
cattctaccaaggtttttcgtgatattgtaaatgcactgggatcttttatacagtccttg
tttcttgtcccccctactggaaatcctgcaacaagcaaccaagctggaaacaataattta
ggtggctcagtctcagcaccagctaactcaggaatggtggggattggtggaggtgttact
ttgctaccagcatttgaatataggggaacctggatacctattctgacaatcacagttcaa
ggcagtgctaaagccacctacttagaaatgttggacaaagttgagcctccaactatacct
gaaggttacgccatgtctgtggcattccattgtttgctagaccttgttcgtggaatcaca
agtatgattgaaggagagctaggagagcttgaaacagaatgtcaaaccaccactgaagaa
ggttcttcaccaacacagtcgacagaacagcaggatttacagtcaacatcagaccaaatg
gataaggaaattgttagtagggctgtttgggaagaaatggtgaatgcctgctggtgtggt
cttcttgctgcactctcactccttcttgatgccagcacagatgaagctgccactgagaat
attttaaaagctgaactgactatggctgctctttgtggaagactgggccttgtaacttca
agagatgcctttataactgcaatatgcaaaggttccctgcctccccattatgctcttact
gtattgaataccaccactgcagctacactttccaacaaatcatattccgttcagggccaa
agtgttatgatgataagtccatcaagtgaatctcaccaacaagttgtggcagtgggtcaa
cctttagcagtccagcctcaagggacagtaatgctgacttccaaaaatatccagtgtatg
aggactttacttaacttggcgcattgccatggggctgttcttggaacatcatggcaactt
gtcttggcaactcttcagcatcttgtgtggattctgggattaaagcctagtagtggcggt
gccttgaaacctgggagagctgtagaaggacccagtacagttctaacaacagcagtgatg
acagatttaccagtgatttccaatatactttcaagattgtttgaaagctcacagtatctt
gatgatgtatcactgcatcatttaataaatgcactttgctccttgtctctagaagcaatg
gatatggcctatggaaataataaggaaccatctctttttgctgttgccaaattgttagaa
actggtttagttaatatgcaccgaatagaaattctgtggagacctctgactggccatcta
cttgaggtctgccagcatccaaactctcgaatgagagaatggggagcagaagctttaact
tctcttattaaagcaggattaacatttaaccatgatcctccactctcacaaaaccagagg
ctgcagttgcttttattgaacccgttaaaggagatgtccaatattaatcatccagatatt
cgactcaagcagttagaatgcgtgttgcagattctgcagagtcagggagacagtcttggg
cctggatggccattagtgcttggagtcatgggagcaatcagaaatgatcaaggagaatcc
ttgatacgaactgcattccagtgtcttcagttggttgtgacagattttctaccaacaatg
ccttgtacttgcctgcaaatagttgtagatgttgcaggtagctttggcctccataaccaa
gaactcaatattagtttaacttcaataggtttattgtggaatatttcagattattttttc
caaagaggggaaactattgaaaaagaactaaataaggaagaggcagcacagcaaaagcag
gcagaagagaaaggagttgttttaaatcggccattccaccctgcaccgccatttgattgc
ttgtggttatgtctttatgcaaaattgggtgaactatgtgtggatccccgtcctgctgtc
aggaagagtgcagggcaaactctgttttctacaattggtgcgcatggaactttattacag
cattcaacctggcacactgttatctggaaggtactctttcatctactggacagagttcga
gagtcctctaccactgcagacaaagaaaagattgagtctggaggtggcaatattctcatt
catcattcaagggacaccgccgagaagcaatgggctgagacgtgggtattaacattggct
ggagtagcaaggatcttcaacactagaagatatttgctgcagcctttaggagatttttca
agagcttgggatgttcttcttgaccatatacagtcagcagcactcagcaaaaacaatgaa
gtatctctggctgctctgaaaagcttccaggaaattttacagattgtgtcccctgtcaga
gactcagataagcctgagacaccacctgtagttaatgtacctgtgcctgttcttataggg
cccatatcaggcatgagcaggccatttgtaagaacagattccattggagaaaaactagga
agatatagtagctctgagccacccattgttactgatgagcttgaagatttgaatctatgg
tgggctgcgtggaatacctggtatagaattggatctgaaagtactaagcctcctattact
tttgataaactaacttttattcctagccagccttttcttacagctttaattcagatattt
ccagctctctaccaacacataaaaactggtttcaatatggatgacttgcaaaagttggga
gtcatattgcacagtgctatttcagtcccaataagttcagatgcatccccttttattctt
ccatcttataccgaagcagttttgacaagtttacaggaagctgtacttacagctttagat
gttctccaaaaggccatttgtgtaggaccagaaaacatgcagataatgtatccagctata
tttgaccagttgttggcatttgtagaattttcctgtaaacctccacagtatggacagctg
gaaacaaagcacattgcaaatgcaaaatataatcagatccaactatttgcaccggcggaa
tgggtagccttgaattatgtgccgtttgctgaaaggtctttagaagtagttgtggattta
taccaaaaaacagcgtgtcacaaagcagtggtgaatgagaaagtgctccagaatattatt
aagactcttagggttcctctcagtttgaagtattcctgcccttctgaaagcacatggaaa
ctagcagtatcctctctcctcagagttctttctattgggctacctgttgcccggcagcat
gcttcttctggaaaatttgacagtatgtggccagaactagccaatacttttgaagatttt
ctctttactaaaagcatacctccagataatctctctattcaagagtttcaaagaaatgaa
aatattgatgtcgaggtagttcaacttatcagcaatgagatactaccttatgccaatttt
attcctaaggaatttgttggtcaaataatgacaatgcttaacaagggctcaatacattct
cagtcatcttcatttacagaagcagagattgatattcgtttgagagaggaattttctaaa
atgtgttttgaaacattactccagttttccttcagtaataaagtcacaacacctcaagaa
ggctacatctcacgaatggcactctcagtgcttttaaagaggtcccaagatgtactacat
cgctatatagaggatgaaagattaagtggtaaatgccctcttccaaggcaacaagtaaca
gaaattatatttgttttaaaagcagtcagtactcttattgattcacttaagaaaactcag
cctgagaatgttgatggaaatacctgggcacaagtaattgccttatacccaactttagta
gaatgcatcacctgttcttcttcagaagtctgttctgcacttaaagaggcactagttcct
tttaaggatttcatgcagccaccagcatccagagttcaaaatggagaatcttga

DBGET integrated database retrieval system