KEGG   Homo sapiens (human): 23043Help
Entry
23043             CDS       T01001                                 

Gene name
TNIK
Definition
(RefSeq) TRAF2 and NCK interacting kinase (EC:2.7.11.1)
  KO
K08840  
TRAF2 and NCK interacting kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     23043 (TNIK)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   23043 (TNIK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q26.31
AA seq 1360 aa AA seqDB search
MASDSPARSLDEIDLSALRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTG
DEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNT
KGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRI
QLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLA
NKERSEALRRQQLEQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQE
REQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQQLLHEQALLLEYKRKQL
EEQRQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEVEER
SRLNRQSSPAMPHKVANRISDPNLPPRSESFSISGVQPARTPPMLRPVDPQIPHLVAVKS
QGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSS
WLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILES
PLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVK
PEESRDITRPSRPASYKKAIDEDLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSE
EEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISRE
GTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSG
TEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKI
SVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVY
NLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGD
LEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVE
EGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYED
EGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKR
AQRLKFLCERNDKVFFASVRSGGSSQVFFMTLNRNSMMNW
NT seq 4083 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgactccccggctcgaagcctggatgaaatagatctctcggctctgagggac
cccgcagggatctttgaattggtggaacttgttggaaatggaacatacgggcaagtttat
aagggtcgtcatgtcaaaacgggccagcttgcagccatcaaggttatggatgtcacaggg
gatgaagaggaagaaatcaaacaagaaattaacatgttgaagaaatattctcatcaccgg
aatattgctacatactatggtgcttttatcaaaaagaacccaccaggcatggatgaccaa
ctttggttggtgatggagttttgtggtgctggctctgtcaccgacctgatcaagaacaca
aaaggtaacacgttgaaagaggagtggattgcatacatctgcagggaaatcttacggggg
ctgagtcacctgcaccagcataaagtgattcatcgagatattaaagggcaaaatgtcttg
ctgactgaaaatgcagaagttaaactagtggactttggagtcagtgctcagcttgatcga
acagtgggcaggaggaatactttcattggaactccctactggatggcaccagaagttatt
gcctgtgatgaaaacccagatgccacatatgatttcaagagtgacttgtggtctttgggt
atcaccgccattgaaatggcagaaggtgctccccctctctgtgacatgcaccccatgaga
gctctcttcctcatcccccggaacccagcgcctcggctgaagtctaagaagtggtcaaaa
aaattccagtcatttattgagagctgcttggtaaagaatcacagccagcgaccagcaaca
gaacaattgatgaagcatccatttatacgagaccaacctaatgagcgacaggtccgcatt
caactcaaggaccatattgatagaacaaagaagaagcgaggagaaaaagatgagacagag
tatgagtacagtggaagtgaggaagaagaggaggagaatgactcaggagagcccagctcc
atcctgaatctgccaggggagtcgacgctgcggagggactttctgaggctgcagctggcc
aacaaggagcgttctgaggccctacggaggcagcagctggagcagcagcagcgggagaat
gaggagcacaagcggcagctgctggccgagcgtcagaagcgcatcgaggagcagaaagag
cagaggcggcggctggaggagcaacaaaggcgagagaaggagctgcggaagcagcaggag
agggagcagcgccggcactatgaggagcagatgcgccgggaggaggagaggaggcgtgcg
gagcatgaacaggaatacatcaggcgacagttagaggaggagcagagacagttagagatc
ttgcagcagcagctactgcatgaacaagctctacttctggaatataagcgcaaacaattg
gaagaacagagacaagcagaaagactgcagaggcagctaaagcaagaaagagactactta
gtttcccttcagcatcagcggcaggagcagaggcctgtggagaagaagccactgtaccat
tacaaagaaggaatgagtcctagtgagaagccagcatgggccaaggaggtagaagaacgg
tcaaggctcaaccggcaaagttcccctgccatgcctcacaaggttgccaacaggatatct
gaccccaacctgcccccaaggtcggagtccttcagcattagtggagttcagcctgctcga
acaccccccatgctcagaccagtcgatccccagatcccacatctggtagctgtaaaatcc
cagggacctgccttgaccgcctcccagtcagtgcacgagcagcccacaaagggcctctct
gggtttcaggaggctctgaacgtgacctcccaccgcgtggagatgccacgccagaactca
gatcccacctcggaaaatcctcctctccccactcgcattgaaaagtttgaccgaagctct
tggttacgacaggaagaagacattccaccaaaggtgcctcaaagaacaacttctatatcc
ccagcattagccagaaagaattctcctgggaatggtagtgctctgggacccagactagga
tctcaacccatcagagcaagcaaccctgatctccggagaactgagcccatcttggagagc
cccttgcagaggaccagcagtggcagttcctccagctccagcacccctagctcccagccc
agctcccaaggaggctcccagcctggatcacaagcaggatccagtgaacgcaccagagtt
cgagccaacagtaagtcagaaggatcacctgtgctcccccatgagcctgccaaggtgaaa
ccagaagaatccagggacattacccggcccagtcgaccagctagctacaaaaaagctata
gatgaggatctgacggcattagccaaagaactaagagaactccggattgaagaaacaaac
cgcccaatgaagaaggtgactgattactcctcctccagtgaggagtcagaaagtagcgag
gaagaggaggaagatggagagagcgagacccatgatgggacagtggctgtcagcgacata
cccagactgataccaacaggagctccaggcagcaacgagcagtacaatgtgggaatggtg
gggacgcatgggctggagacctctcatgcggacagtttcagcggcagtatttcaagagaa
ggaaccttgatgattagagagacgtctggagagaagaagcgatctggccacagtgacagc
aatggctttgctggccacatcaacctccctgacctggtgcagcagagccattctccagct
ggaaccccgactgagggactggggcgcgtctcaacccattcccaggagatggactctggg
actgaatatggcatggggagcagcaccaaagcctccttcaccccctttgtggaccccaga
gtataccagacgtctcccactgatgaagatgaagaggatgaggaatcatcagccgcagct
ctgtttactagcgaacttcttaggcaagaacaggccaaactcaatgaagcaagaaagatt
tcggtggtaaatgtaaacccaaccaacattcggcctcatagcgacacaccagaaatcaga
aaatacaagaaacgattcaactcagaaatactttgtgcagctctgtggggtgtaaacctt
ctggtggggactgaaaatggcctgatgcttttggaccgaagtgggcaaggcaaagtctat
aatctgatcaaccggaggcgatttcagcagatggatgtgctagagggactgaatgtcctt
gtgacaatttcaggaaagaagaataagctacgagtttactatctttcatggttaagaaac
agaatactacataatgacccagaagtagaaaagaaacaaggctggatcactgttggggac
ttggaaggctgtatacattataaagttgttaaatatgaaaggatcaaatttttggtgatt
gccttaaagaatgctgtggaaatatatgcttgggctcctaaaccgtatcataaattcatg
gcatttaagtcttttgcagatctccagcacaagcctctgctagttgatctcacggtagaa
gaaggtcaaagattaaaggttatttttggttcacacactggtttccatgtaattgatgtt
gattcaggaaactcttatgatatctacataccatctcatattcagggcaatatcactcct
catgctattgtcatcttgcctaaaacagatggaatggaaatgcttgtttgctatgaggat
gagggggtgtatgtaaacacctatggccggataactaaggatgtggtgctccaatgggga
gaaatgcccacgtctgtggcctacattcattccaatcagataatgggctggggcgagaaa
gctattgagatccggtcagtggaaacaggacatttggatggagtatttatgcataagcga
gctcaaaggttaaagtttctatgtgaaagaaatgataaggtattttttgcatccgtgcga
tctggaggaagtagccaagtgtttttcatgaccctcaacagaaattccatgatgaactgg
taa

DBGET integrated database retrieval system