KEGG   Homo sapiens (human): 23049Help
Entry
23049             CDS       T01001                                 

Gene name
SMG1, 61E3.4, ATX, LIP
Definition
SMG1 phosphatidylinositol 3-kinase-related kinase (EC:2.7.11.1)
Orthology
K08873  
PI-3-kinase-related kinase SMG-1
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:hsa03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p12.3
AA seq 3661 aa AA seqDB search
MSRRAPGSRLSSGGGGGGTKYPRSWNDWQPRTDSASADPDNLKYSSSRDRGGSSSYGLQP
SNSAVVSRQRHDDTRVHADIQNDEKGGYSVNGGSGENTYGRKSLGQELRVNNVTSPEFTS
VQHGSRALATKDMRKSQERSMSYSDESRLSNLLRRITREDDRDRRLATVKQLKEFIQQPE
NKLVLVKQLDNILAAVHDVLNESSKLLQELRQEGACCLGLLCASLSYEAEKIFKWIFSKF
SSSAKDEVKLLYLCATYKALETVGEKKAFSSVMQLVMTSLQSILENVDTPELLCKCVKCI
LLVARCYPHIFSTNFRDTVDILVGWHIDHTQKPSLTQQVSGWLQSLEPFWVADLAFSTTL
LGQFLEDMEAYAEDLSHVASGESVDEDVPPPSVSLPKLAALLRVFSTVVRSIGERFSPIR
GPPITEAYVTDVLYRVMRCVTAANQVFFSEAVLTAANECVGVLLGSLDPSMTIHCDMVIT
YGLDQLENCQTCGTDYIISVLNLLTLIVEQINTKLPSSFVEKLFIPSSKLLFLRYHKEKE
VVAVAHAVYQAVLSLKNIPVLETAYKLILGEMTCALNNLLHSLQLPEACSEIKHEAFKNH
VFNVDNAKFVVIFDLSALTTIGNAKNSLIGMWALSPTVFALLSKNLMIVHSDLAVHFPAI
QYAVLYTLYSHCTRHDHFISSSLSSSSPSLFDGAVISTVTTATKKHFSIILNLLGILLKK
DNLNQDTRKLLMTWALEAAVLMKKSETYAPLFSLPSFHKFCKGLLANTLVEDVNICLQAC
SSLHALSSSLPDDLLQRCVDVCRVQLVHSGTRIRQAFGKLLKSIPLDVVLSNNNHTEIQE
ISLALRSHMSKAPSNTFHPQDFSDVISFILYGNSHRTGKDNWLERLFYSCQRLDKRDQST
IPRNLLKTDAVLWQWAIWEAAQFTVLSKLRTPLGRAQDTFQTIEGIIRSLAAHTLNPDQD
VSQWTTADNDEGHGNNQLRLVLLLQYLENLEKLMYNAYEGCANALTSPPKVIRTFFYTNR
QTCQDWLTRIRLSIMRVGLLAGQPAVTVRHGFDLLTEMKTTSLSQGNELEVTIMMVVEAL
CELHCPEAIQGIAVWSSSIVGKNLLWINSVAQQAEGRFEKASVEYQEHLCAMTGVDCCIS
SFDKSVLTLANAGRNSASPKHSLNGESRKTVLSKPTDSSPEVINYLGNKACECYISIADW
AAVQEWQNAIHDLKKSTSSTSLNLKADFNYIKSLSSFESGKFVECTEQLELLPGENINLL
AGGSKEKIDMKKLLPNMLSPDPRELQKSIEVQLLRSSVCLATALNPIEQDQKWQSITENV
VKYLKQTSRIAIGPLRLSTLTVSQSLPVLSTLQLYCSSALENTVSNRLSTEDCLIPLFSE
ALRSCKQHDVRPWMQALRYTMYQNQLLEKIKEQTVPIRSHLMELGLTAAKFARKRGNVSL
ATRLLAQCSEVQLGKTTTAQDLVQHFKKLSTQGQVDEKWGPELDIEKTKLLYTAGQSTHA
MEMLSSCAISFCKSVKAEYAVAKSILTLAKWIQAEWKEISGQLKQVYRAQHQQNFTGLST
LSKNILTLIELPSVNTMEEEYPRIESESTVHIGVGEPDFILGQLYHLSSVQAPEVAKSWA
ALASWAYRWGRKVVDNASQGEGVRLLPREKSEVQNLLPDTITEEEKERIYGILGQAVCRP
AGIQDEDITLQITESEDNEEDDMVDVIWRQLISSCPWLSELDESATEGVIKVWRKVVDRI
FSLYKLSCSAYFTFLKLNAGQIPLDEDDPRLHLSHRVEQSTDDMIVMATLRLLRLLVKHA
GELRQYLEHGLETTPTAPWRGIIPQLFSRLNHPEVYVRQSICNLLCRVAQDSPHLILYPA
IVGTISLSSESQASGNKFSTAIPTLLGNIQGEELLVSECEGGSPPASQDSNKDEPKSGLN
EDQAMMQDCYSKIVDKLSSANPTMVLQVQMLVAELRRVTVLWDELWLGVLLQQHMYVLRR
IQQLEDEVKRVQNNNTLRKEEKIAIMREKHTALMKPIVFALEHVRSITAAPAETPHEKWF
QDNYGDAIENALEKLKTPLNPAKPGSSWIPFKEIMLSLQQRAQKRASYILRLEEISPWLA
AMTNTEIALPGEVSARDTVTIHSVGGTITILPTKTKPKKLLFLGSDGKSYPYLFKGLEDL
HLDERIMQFLSIVNTMFATINRQETPRFHARHYSVTPLGTRSGLIQWVDGATPLFGLYKR
WQQREAALQAQKAQDSYQTPQNPGIVPRPSELYYSKIGPALKTVGLSLDVSRRDWPLHVM
KAVLEELMEATPPNLLAKELWSSCTTPDEWWRVTQSYARSTAVMSMVGYIIGLGDRHLDN
VLIDMTTGEVVHIDYNVCFEKGKSLRVPEKVPFRMTQNIETALGVTGVEGVFRLSCEQVL
HIMRRGRETLLTLLEAFVYDPLVDWTAGGEAGFAGAVYGGGGQQAESKQSKREMEREITR
SLFSSRVAEIKVNWFKNRDEMLVVLPKLDGSLDEYLSLQEQLTDVEKLQGKLLEEIEFLE
GAEGVDHPSHTLQHRYSEHTQLQTQQRAVQEAIQVKLNEFEQWITHYQAAFNNLEATQLA
SLLQEISTQMDLGPPSYVPATAFLQNAGQAHLISQCEQLEGEVGALLQQRRSVLRGCLEQ
LHHYATVALQYPKAIFQKHRIEQWKTWMEELICNTTVERCQELYRKYEMQYAPQPPPTVC
QFITATEMTLQRYAADINSRLIRQVERLKQEAVTVPVCEDQLKEIERCIKVFLHENGEEG
SLSLASVIISALCTLTRRNLMMEGAASSAGEQLVDLTSRDGAWFLEELCSMSGNVTCLVQ
LLKQCHLVPQDLDIPNPMEASETVHLANGVYTSLQELNSNFRQIIFPEALRCLMKGEYTL
ESMLHELDGLIEQTTDGVPLQTLVESLQAYLRNAAMGLEEETHAHYIDVARLLHAQYGEL
IQPRNGSVDETPKMSAGQMLLVAFDGMFAQVETAFSLLVEKLNKMEIPIAWRKIDIIREA
RSTQVNFFDDDNHRQVLEEIFFLKRLQTIKEFFRLCGTFSKTLSGSSSLEDQNTVNGPVQ
IVNVKTLFRNSCFSEDQMAKPIKAFTADFVRQLLIGLPNQALGLTLCSFISALGVDIIAQ
VEAKDFGAESKVSVDDLCKKAVEHNIQIGKFSQLVMNRATVLASSYDTAWKKHDLVRRLE
TSISSCKTSLQRVQLHIAMFQWQHEDLLINRPQAMSVTPPPRSAILTSMKKKLHTLSQIE
TSIATVQEKLAALESSIEQRLKWAGGANPALAPVLQDFEATIAERRNLVLKESQRASQVT
FLCSNIIHFESLRTRTAEALNLDAALFELIKRCQQMCSFASQFNSSVSELELRLLQRVDT
GLEHPIGSSEWLLSAHKQLTQDMSTQRAIQTEKEQQIETVCETIQNLVDNIKTVLTGHNR
QLGDVKHLLKAMAKDEEAALADGEDVPYENSVRQFLGEYKSWQDNIQTVLFTLVQAMGQV
RSQEHVEMLQEITPTLKELKTQSQSIYNNLVSFASPLVTDATNECSSPTSSATYQPSFAA
AVRSNTGQKTQPDVMSQNARKLIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGK
AVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAW
V
NT seq 10986 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcagagccccggggtctcggctgagcagcggcggcggcggcggcggcaccaag
tatccgcggagctggaatgactggcaacccagaactgatagtgcatcagccgacccagat
aatttaaaatattcttcatccagagatagaggtggttcttcctcttatggactgcaacct
tcaaattcagctgtggtgtctcggcaaaggcacgatgataccagagtccacgctgacata
cagaatgacgaaaagggtggctacagtgtcaatggaggatctggggaaaatacttatggt
cggaagtcgttggggcaagagctgagggttaacaatgtgaccagccctgagttcaccagt
gttcagcatggcagtcgtgctttagccaccaaagacatgaggaaatcacaggagagatcg
atgtcttattctgatgagtctcgactgtcgaatcttcttcggaggatcacccgggaagac
gacagagaccgaagattggctactgtaaagcagttgaaagaatttattcagcaaccagaa
aataagctggtactagttaaacaattggataatatcttggctgctgtacatgacgtgctt
aatgaaagtagcaaattgcttcaggagttgagacaggagggagcttgctgtcttggcctt
ctttgtgcttctctgagctatgaggctgagaagatcttcaagtggatttttagcaaattt
agctcatctgcaaaagatgaagttaaactcctctacttatgtgccacctacaaagcacta
gagactgtaggagaaaagaaagccttttcatctgtaatgcagcttgtaatgaccagcctg
cagtctattcttgaaaatgtggatacaccagaattgctttgtaaatgtgttaagtgcatt
cttttggtggctcgatgttaccctcatattttcagcactaattttagggatacagttgat
atattagttggatggcatatagatcatactcagaaaccttcgctcacgcagcaggtatct
gggtggttgcagagtttggagccattttgggtagctgatcttgcattttctactactctt
cttggtcagtttctggaagacatggaagcatatgctgaggacctcagccatgtggcctct
ggggaatcagtggatgaagatgtccctcctccatcagtgtcattaccaaagctggctgca
cttctccgggtatttagtactgtggtgaggagcattggggaacgcttcagcccaattcgg
ggtcctccaattactgaggcatatgtaacagatgttctgtacagagtaatgagatgtgtg
acggctgcaaaccaggtgtttttttctgaggctgtgttgacagctgctaatgagtgtgtt
ggtgttttgctcggcagcttggatcctagcatgactatacattgtgacatggtcattaca
tatggattagaccaactggagaattgccagacttgtggtaccgattatatcatctcagtc
ttgaatttactcacgctgattgttgaacagataaatacgaaactgccatcatcatttgta
gaaaaactgtttataccatcatctaaactactattcttgcgttatcataaagaaaaagag
gttgttgctgtagcccatgctgtttatcaagcagtgctcagcttgaagaatattcctgtt
ttggagactgcctataagttaatattgggagaaatgacttgtgccctaaacaacctccta
cacagtctacaacttcctgaggcctgttctgaaataaaacatgaggcttttaagaatcat
gtgttcaatgtagacaatgcaaaatttgtagttatatttgacctcagtgccctgactaca
attggaaatgccaaaaactcactaatagggatgtgggcgctatctccaactgtctttgca
cttctgagtaagaatctgatgattgtgcacagtgacctggctgttcacttccctgccatt
cagtatgctgtgctctacacattgtattctcattgtaccaggcatgatcactttatctct
agtagcctcagttcttcctctccttctttgtttgatggagctgtgattagcactgtaact
acggctacaaagaaacatttctcaattatattaaatcttctgggaatattacttaagaaa
gataaccttaaccaggacacgaggaaactgttaatgacttgggctttggaagcagctgtt
ttaatgaagaagtctgaaacatacgcacctttattctctcttccgtctttccataaattt
tgcaaaggccttttagccaacactctcgttgaagatgtgaatatctgtctgcaggcatgc
agcagtctacatgctctgtcctcttccttgccagatgatcttttacagagatgtgtcgat
gtttgccgtgttcaactagtgcacagtggaactcgtattcgacaagcatttggaaaactg
ttgaaatcaattcctttagatgttgtcctaagcaataacaatcacacagaaattcaagaa
atttctttagcattaagaagtcacatgagtaaagcaccaagtaatacattccacccccaa
gatttctctgatgttattagttttattttgtatgggaactctcatagaacagggaaggac
aattggttggaaagactgttctatagctgccagagactggataagcgtgaccagtcaaca
attccacgcaatctcctgaagacagatgctgtcctttggcagtgggccatatgggaagct
gcacaattcactgttctttctaagctgagaaccccactgggcagagctcaagacaccttc
cagacaattgaaggtatcattcgaagtctcgcagctcacacattaaaccctgatcaggat
gttagtcagtggacaactgcagacaatgatgaaggccatggtaacaaccaacttagactt
gttcttcttctgcagtatctggaaaatctggagaaattaatgtataatgcatacgaggga
tgtgctaatgcattaacttcacctcccaaggtcattagaacttttttctataccaatcgc
caaacttgtcaggactggctaacgcggattcgactctccatcatgagggtaggattgttg
gcaggccagcctgcagtgacagtgagacatggctttgacttgcttacagagatgaaaaca
accagcctatctcaggggaatgaattggaagtaaccattatgatggtggtagaagcatta
tgtgaacttcattgtcctgaagctatacagggaattgctgtctggtcatcatctattgtt
ggaaaaaatcttctgtggattaactcagtggctcaacaggctgaagggaggtttgaaaag
gcctctgtggagtaccaggaacacctgtgtgccatgacaggtgttgattgctgcatctcc
agctttgacaaatcggtgctcaccttagccaatgctgggcgtaacagtgccagcccgaaa
cattctctgaatggtgaatccagaaaaactgtgctgtccaaaccgactgactcttcccct
gaggttataaattatttaggaaataaagcatgtgagtgctacatctcaattgccgattgg
gctgctgtgcaggaatggcagaacgctatccatgacttgaaaaagagtaccagtagcact
tccctcaacctgaaagctgacttcaactatataaaatcattaagcagctttgagtctgga
aaatttgttgaatgtaccgagcagttagaattgttaccaggagaaaatatcaatctactt
gctggaggatcaaaagaaaaaatagacatgaaaaaactgcttcctaacatgttaagtccg
gatccgagggaacttcagaaatccattgaagttcaattgttaagaagttctgtttgtttg
gcaactgctttaaacccgatagaacaagatcagaagtggcagtctataactgaaaatgtg
gtaaagtacttgaagcaaacatcccgcatcgctattggacctctgagactttctacttta
acagtttcacagtctttgccagttctaagtaccttgcagctgtattgctcatctgctttg
gagaacacagtttctaacagactttcaacagaggactgtcttattccactcttcagtgaa
gctttacgttcatgtaaacagcatgacgtgaggccatggatgcaggcattaaggtatact
atgtaccagaatcagttgttggagaaaattaaagaacaaacagtcccaattagaagccat
ctcatggaattaggtctaacagcagcaaaatttgctagaaaacgagggaatgtgtccctt
gcaacaagactgctggcacagtgcagtgaagttcagctgggaaagaccaccactgcacag
gatttagtccaacattttaaaaaactatcaacccaaggtcaagtggatgaaaaatggggg
cccgaacttgatattgaaaaaaccaaattgctttatacagcaggccagtcaacacatgca
atggaaatgttgagttcttgtgccatatctttctgcaagtctgtgaaagctgaatatgca
gttgctaaatcaattctgacactggctaaatggatccaggcagaatggaaagagatttca
ggacagctgaaacaggtttacagagctcagcaccaacagaacttcacaggtctttctact
ttgtctaaaaacatactcactctaatagaactgccatctgttaatacgatggaagaagag
tatcctcggatcgagagtgaatctacagtgcatattggagttggagaacctgacttcatt
ttgggacagttgtatcacctgtcttcagtacaggcacctgaagtagccaaatcttgggca
gcgttggccagctgggcttataggtggggcagaaaggtggttgacaatgccagtcaggga
gaaggtgttcgtctgctgcctagagaaaaatctgaagttcagaatctacttccagacact
ataactgaggaagagaaagagagaatatatggtattcttggacaggctgtgtgtcggccg
gcggggattcaggatgaagatataacacttcagataactgagagtgaagacaacgaagaa
gatgacatggttgatgttatctggcgtcagttgatatcaagctgcccatggctttcagaa
cttgatgaaagtgcaactgaaggagttattaaagtgtggaggaaagttgtagatagaata
ttcagcctgtacaaactctcttgcagtgcatactttactttccttaaactcaacgctggt
caaattcctttagatgaggatgaccctaggctgcatttaagtcacagagtggaacagagc
actgatgacatgattgtgatggccacattgcgcctgctgcggttgctcgtgaagcatgct
ggtgagcttcggcagtatctggagcacggcttggagacaacacccactgcaccatggaga
ggaattattccgcaacttttctcacgcttaaaccaccctgaagtgtatgtgcgccaaagt
atttgtaaccttctctgccgtgtggctcaagattccccacatctcatattgtatcctgca
atagtgggtaccatatcgcttagtagtgaatcccaggcttcaggaaataaattttccact
gcaattccaactttacttggcaatattcaaggagaagaattgctggtttctgaatgtgag
ggaggaagtcctcctgcatctcaggatagcaataaggatgaacctaaaagtggattaaat
gaagaccaagccatgatgcaggattgttacagcaaaattgtagataagctgtcctctgca
aaccccaccatggtattacaggttcagatgctcgtggctgaactgcgcagggtcactgtg
ctctgggatgagctctggctgggagttttgctgcaacaacacatgtatgtcctgagacga
attcagcagcttgaagatgaggtgaagagagtccagaacaacaacaccttacgcaaagaa
gagaaaattgcaatcatgagggagaagcacacagctttgatgaagcccatcgtatttgct
ttggagcatgtgaggagtatcacagcggctcctgcagaaacacctcatgaaaaatggttt
caggataactatggtgatgccattgaaaatgccctagaaaaactgaagactccattgaac
cctgcaaagcctgggagcagctggattccatttaaagagataatgctaagtttgcaacag
agagcacagaaacgtgcaagttacatcttgcgtcttgaagaaatcagtccatggttggct
gccatgactaacactgaaattgctcttcctggggaagtctcagccagagacactgtcaca
atccatagtgtgggcggaaccatcacaatcttaccgactaaaaccaagccaaagaaactt
ctctttcttggatcagatgggaagagctatccttatcttttcaaaggactggaggattta
catctggatgagagaataatgcagttcctatctattgtgaataccatgtttgctacaatt
aatcgccaagaaacaccccggttccatgctcgacactattctgtaacaccactaggaaca
agatcaggactaatccagtgggtagatggagccacacccttatttggtctttacaaacga
tggcaacaacgggaagctgccttacaagcacaaaaggcccaagattcctaccaaactcct
cagaatcctggaattgtaccccgtcctagtgaactttattacagtaaaattggccctgct
ttgaaaacagttgggcttagcctggatgtgtcccgtcgggattggcctcttcatgtaatg
aaggcagtattggaagagttaatggaggccacacccccgaatctccttgccaaagagctc
tggtcatcttgcacaacacctgatgaatggtggagagttacgcagtcttatgcaagatct
actgcagtcatgtctatggttggatacataattggccttggagacagacatctggataat
gttcttatagatatgacgactggagaagttgttcacatagattacaatgtttgctttgaa
aaaggtaaaagccttagagttcctgagaaagtaccttttcgaatgacacaaaacattgaa
acagcactgggtgtaactggagtagaaggtgtatttaggctttcatgtgagcaggtttta
cacattatgcggcgtggcagagagaccctgctgacgctgctggaggcctttgtgtacgac
cctctggtggactggacagcaggaggcgaggctgggtttgctggtgctgtctatggtgga
ggtggccagcaggccgagagcaagcagagcaagagagagatggagcgagagatcacccgc
agcctgttttcttctagagtagctgagattaaggtgaactggtttaagaatagagatgag
atgctggttgtgcttcccaagttggacggtagcttagatgaatacctaagcttgcaagag
caactgacagatgtggaaaaactgcagggcaaactactggaggaaatagagtttctagaa
ggagctgaaggggtggatcatccttctcatactctgcaacacaggtattctgagcacacc
caactacagactcagcaaagagctgttcaggaagcaatccaggtgaagctgaatgaattt
gaacaatggataacacattatcaggctgcattcaataatttagaagcaacacagcttgca
agcttgcttcaagagataagcacacaaatggaccttggtcctccaagttacgtgccagca
acagcctttctgcagaatgctggtcaggcccacttgattagccagtgcgagcagctggag
ggggaggttggtgctctcctgcagcagaggcgctccgtgctccgtggctgtctggagcaa
ctgcatcactatgcaaccgtggccctgcagtatccgaaggccatatttcagaaacatcga
attgaacagtggaagacctggatggaagagctcatctgtaacaccacagtagagcgttgt
caagagctctataggaaatatgaaatgcaatatgctccccagccacccccaacagtgtgt
cagttcatcactgccactgaaatgaccctgcagcgatacgcagcagacatcaacagcaga
cttattagacaagtggaacgcttgaaacaggaagctgtcactgtgccagtttgtgaagat
cagttgaaagaaattgaacgttgcattaaagttttccttcatgagaatggagaagaagga
tctttgagtctagcaagtgttattatttctgccctttgtacccttacaaggcgtaacctg
atgatggaaggtgcagcgtcaagtgctggagaacagctggttgatctgacttctcgggat
ggagcctggttcttggaggaactctgcagtatgagcggaaacgtcacctgcttggttcag
ttactgaagcagtgccacctggtgccacaggacttagatatcccgaaccccatggaagcg
tctgagacagttcacttagccaatggagtgtatacctcacttcaggaattgaattcgaat
ttccggcaaatcatatttccagaagcacttcgatgtttaatgaaaggggaatacacgtta
gaaagtatgctgcatgaactggacggtcttattgagcagaccaccgatggcgttcccctg
cagactctagtggaatctcttcaggcctacttaagaaacgcagctatgggactggaagaa
gaaacacatgctcattacatcgatgttgccagactactacatgctcagtacggtgaatta
atccaaccgagaaatggttcagttgatgaaacacccaaaatgtcagctggccagatgctt
ttggtagcattcgatggcatgtttgctcaagttgaaactgctttcagcttattagttgaa
aagttgaacaagatggaaattcccatagcttggcgaaagattgacatcataagggaagcc
aggagtactcaagttaatttttttgatgatgataatcaccggcaggtgctagaagagatt
ttctttctaaaaagactacagactattaaggagttcttcaggctctgtggtaccttttct
aaaacattgtcaggatcaagttcacttgaagatcagaatactgtgaatgggcctgtacag
attgtcaatgtgaaaaccctttttagaaactcttgtttcagtgaagaccaaatggccaaa
cctatcaaggcattcacagctgactttgtgaggcagctcttgatagggctacccaaccaa
gccctcggactcacactgtgcagttttatcagtgctctgggtgtagacatcattgctcaa
gtagaggcaaaggactttggtgccgaaagcaaagtttctgttgatgatctctgtaagaaa
gcggtggaacataacatccagatagggaagttctctcagctggttatgaacagggcaact
gtgttagcaagttcttacgacactgcctggaagaagcatgacttggtgcgaaggctagaa
accagtatttcttcttgtaagacaagcctgcagcgggttcagctgcatattgccatgttt
cagtggcaacatgaagatctacttatcaatagaccacaagccatgtcagtcacacctccc
ccacggtctgctatcctaaccagcatgaaaaagaagctgcataccctgagccagattgaa
acttctattgcaacagttcaggagaagctagctgcacttgaatcaagtattgaacagcga
ctcaagtgggcaggtggtgccaaccctgcattggcccctgtactacaagattttgaagca
acgatagctgaaagaagaaatcttgtccttaaagagagccaaagagcaagtcaggtcaca
tttctctgcagcaatatcattcattttgaaagtttacgaacaagaactgcagaagcctta
aacctggatgcggcgttatttgaactaatcaagcgatgtcagcagatgtgttcgtttgca
tcacagtttaacagttcagtgtctgagttagagcttcgtttattacagagagtggacact
ggtcttgaacatcctattggcagctctgaatggcttttgtcagcacacaaacagttgacc
caggatatgtctactcagagggcaattcagacagagaaagagcagcagatagaaacggtc
tgtgaaacaattcagaatctggttgataatataaagactgtgctcactggtcataaccga
cagcttggagatgtcaaacatctcttgaaagctatggctaaggatgaagaagctgctctg
gcagatggtgaagatgttccctatgagaacagtgttaggcagtttttgggtgaatataaa
tcatggcaagacaacattcaaacagttctatttacattagtccaggctatgggtcaggtt
cgaagtcaagaacacgttgaaatgctccaggaaatcactcccaccttgaaagaactgaaa
acacaaagtcagagtatctataataatttagtgagttttgcatcacccttagtcaccgat
gcaacaaatgaatgttcgagtccaacgtcatctgctacttatcagccatccttcgctgca
gcagtccggagtaacactggccagaagactcagcctgatgtcatgtcacagaatgctaga
aagctgatccagaaaaatcttgctacatcagctgatactccaccaagcaccgttccagga
actggcaagagtgttgcttgtagtcctaaaaaggcagtcagagaccctaaaactgggaaa
gcggtgcaagagagaaactcctatgcagtgagtgtgtggaagagagtgaaagccaagtta
gagggccgagatgttgatccgaataggaggatgtcagttgctgaacaggttgactatgtc
attaaggaagcaactaatctagataacttggctcagctgtatgaaggttggacagcctgg
gtgtga

DBGET integrated database retrieval system