KEGG   Homo sapiens (human): 23049Help
Entry
23049             CDS       T01001                                 

Gene name
SMG1, 61E3.4, ATX, LIP
Definition
(RefSeq) SMG1 phosphatidylinositol 3-kinase-related kinase (EC:2.7.11.1)
  KO
K08873  
PI-3-kinase-related kinase SMG-1
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    23049 (SMG1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   23049 (SMG1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Surveillance factors
    Other surveillance  factors
     23049 (SMG1)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     23049 (SMG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p12.3
AA seq 3661 aa AA seqDB search
MSRRAPGSRLSSGGGGGGTKYPRSWNDWQPRTDSASADPDNLKYSSSRDRGGSSSYGLQP
SNSAVVSRQRHDDTRVHADIQNDEKGGYSVNGGSGENTYGRKSLGQELRVNNVTSPEFTS
VQHGSRALATKDMRKSQERSMSYSDESRLSNLLRRITREDDRDRRLATVKQLKEFIQQPE
NKLVLVKQLDNILAAVHDVLNESSKLLQELRQEGACCLGLLCASLSYEAEKIFKWIFSKF
SSSAKDEVKLLYLCATYKALETVGEKKAFSSVMQLVMTSLQSILENVDTPELLCKCVKCI
LLVARCYPHIFSTNFRDTVDILVGWHIDHTQKPSLTQQVSGWLQSLEPFWVADLAFSTTL
LGQFLEDMEAYAEDLSHVASGESVDEDVPPPSVSLPKLAALLRVFSTVVRSIGERFSPIR
GPPITEAYVTDVLYRVMRCVTAANQVFFSEAVLTAANECVGVLLGSLDPSMTIHCDMVIT
YGLDQLENCQTCGTDYIISVLNLLTLIVEQINTKLPSSFVEKLFIPSSKLLFLRYHKEKE
VVAVAHAVYQAVLSLKNIPVLETAYKLILGEMTCALNNLLHSLQLPEACSEIKHEAFKNH
VFNVDNAKFVVIFDLSALTTIGNAKNSLIGMWALSPTVFALLSKNLMIVHSDLAVHFPAI
QYAVLYTLYSHCTRHDHFISSSLSSSSPSLFDGAVISTVTTATKKHFSIILNLLGILLKK
DNLNQDTRKLLMTWALEAAVLMKKSETYAPLFSLPSFHKFCKGLLANTLVEDVNICLQAC
SSLHALSSSLPDDLLQRCVDVCRVQLVHSGTRIRQAFGKLLKSIPLDVVLSNNNHTEIQE
ISLALRSHMSKAPSNTFHPQDFSDVISFILYGNSHRTGKDNWLERLFYSCQRLDKRDQST
IPRNLLKTDAVLWQWAIWEAAQFTVLSKLRTPLGRAQDTFQTIEGIIRSLAAHTLNPDQD
VSQWTTADNDEGHGNNQLRLVLLLQYLENLEKLMYNAYEGCANALTSPPKVIRTFFYTNR
QTCQDWLTRIRLSIMRVGLLAGQPAVTVRHGFDLLTEMKTTSLSQGNELEVTIMMVVEAL
CELHCPEAIQGIAVWSSSIVGKNLLWINSVAQQAEGRFEKASVEYQEHLCAMTGVDCCIS
SFDKSVLTLANAGRNSASPKHSLNGESRKTVLSKPTDSSPEVINYLGNKACECYISIADW
AAVQEWQNAIHDLKKSTSSTSLNLKADFNYIKSLSSFESGKFVECTEQLELLPGENINLL
AGGSKEKIDMKKLLPNMLSPDPRELQKSIEVQLLRSSVCLATALNPIEQDQKWQSITENV
VKYLKQTSRIAIGPLRLSTLTVSQSLPVLSTLQLYCSSALENTVSNRLSTEDCLIPLFSE
ALRSCKQHDVRPWMQALRYTMYQNQLLEKIKEQTVPIRSHLMELGLTAAKFARKRGNVSL
ATRLLAQCSEVQLGKTTTAQDLVQHFKKLSTQGQVDEKWGPELDIEKTKLLYTAGQSTHA
MEMLSSCAISFCKSVKAEYAVAKSILTLAKWIQAEWKEISGQLKQVYRAQHQQNFTGLST
LSKNILTLIELPSVNTMEEEYPRIESESTVHIGVGEPDFILGQLYHLSSVQAPEVAKSWA
ALASWAYRWGRKVVDNASQGEGVRLLPREKSEVQNLLPDTITEEEKERIYGILGQAVCRP
AGIQDEDITLQITESEDNEEDDMVDVIWRQLISSCPWLSELDESATEGVIKVWRKVVDRI
FSLYKLSCSAYFTFLKLNAGQIPLDEDDPRLHLSHRVEQSTDDMIVMATLRLLRLLVKHA
GELRQYLEHGLETTPTAPWRGIIPQLFSRLNHPEVYVRQSICNLLCRVAQDSPHLILYPA
IVGTISLSSESQASGNKFSTAIPTLLGNIQGEELLVSECEGGSPPASQDSNKDEPKSGLN
EDQAMMQDCYSKIVDKLSSANPTMVLQVQMLVAELRRVTVLWDELWLGVLLQQHMYVLRR
IQQLEDEVKRVQNNNTLRKEEKIAIMREKHTALMKPIVFALEHVRSITAAPAETPHEKWF
QDNYGDAIENALEKLKTPLNPAKPGSSWIPFKEIMLSLQQRAQKRASYILRLEEISPWLA
AMTNTEIALPGEVSARDTVTIHSVGGTITILPTKTKPKKLLFLGSDGKSYPYLFKGLEDL
HLDERIMQFLSIVNTMFATINRQETPRFHARHYSVTPLGTRSGLIQWVDGATPLFGLYKR
WQQREAALQAQKAQDSYQTPQNPGIVPRPSELYYSKIGPALKTVGLSLDVSRRDWPLHVM
KAVLEELMEATPPNLLAKELWSSCTTPDEWWRVTQSYARSTAVMSMVGYIIGLGDRHLDN
VLIDMTTGEVVHIDYNVCFEKGKSLRVPEKVPFRMTQNIETALGVTGVEGVFRLSCEQVL
HIMRRGRETLLTLLEAFVYDPLVDWTAGGEAGFAGAVYGGGGQQAESKQSKREMEREITR
SLFSSRVAEIKVNWFKNRDEMLVVLPKLDGSLDEYLSLQEQLTDVEKLQGKLLEEIEFLE
GAEGVDHPSHTLQHRYSEHTQLQTQQRAVQEAIQVKLNEFEQWITHYQAAFNNLEATQLA
SLLQEISTQMDLGPPSYVPATAFLQNAGQAHLISQCEQLEGEVGALLQQRRSVLRGCLEQ
LHHYATVALQYPKAIFQKHRIEQWKTWMEELICNTTVERCQELYRKYEMQYAPQPPPTVC
QFITATEMTLQRYAADINSRLIRQVERLKQEAVTVPVCEDQLKEIERCIKVFLHENGEEG
SLSLASVIISALCTLTRRNLMMEGAASSAGEQLVDLTSRDGAWFLEELCSMSGNVTCLVQ
LLKQCHLVPQDLDIPNPMEASETVHLANGVYTSLQELNSNFRQIIFPEALRCLMKGEYTL
ESMLHELDGLIEQTTDGVPLQTLVESLQAYLRNAAMGLEEETHAHYIDVARLLHAQYGEL
IQPRNGSVDETPKMSAGQMLLVAFDGMFAQVETAFSLLVEKLNKMEIPIAWRKIDIIREA
RSTQVNFFDDDNHRQVLEEIFFLKRLQTIKEFFRLCGTFSKTLSGSSSLEDQNTVNGPVQ
IVNVKTLFRNSCFSEDQMAKPIKAFTADFVRQLLIGLPNQALGLTLCSFISALGVDIIAQ
VEAKDFGAESKVSVDDLCKKAVEHNIQIGKFSQLVMNRATVLASSYDTAWKKHDLVRRLE
TSISSCKTSLQRVQLHIAMFQWQHEDLLINRPQAMSVTPPPRSAILTSMKKKLHTLSQIE
TSIATVQEKLAALESSIEQRLKWAGGANPALAPVLQDFEATIAERRNLVLKESQRASQVT
FLCSNIIHFESLRTRTAEALNLDAALFELIKRCQQMCSFASQFNSSVSELELRLLQRVDT
GLEHPIGSSEWLLSAHKQLTQDMSTQRAIQTEKEQQIETVCETIQNLVDNIKTVLTGHNR
QLGDVKHLLKAMAKDEEAALADGEDVPYENSVRQFLGEYKSWQDNIQTVLFTLVQAMGQV
RSQEHVEMLQEITPTLKELKTQSQSIYNNLVSFASPLVTDATNECSSPTSSATYQPSFAA
AVRSNTGQKTQPDVMSQNARKLIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGK
AVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAW
V
NT seq 10986 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcagagccccggggtctcggctgagcagcggcggcggcggcggcggcaccaag
tatccgcggagctggaatgactggcaacccagaactgatagtgcatcagccgacccagat
aatttaaaatattcttcatccagagatagaggtggttcttcctcttatggactgcaacct
tcaaattcagctgtggtgtctcggcaaaggcacgatgataccagagtccacgctgacata
cagaatgacgaaaagggtggctacagtgtcaatggaggatctggggaaaatacttatggt
cggaagtcgttggggcaagagctgagggttaacaatgtgaccagccctgagttcaccagt
gttcagcatggcagtcgtgctttagccaccaaagacatgaggaaatcacaggagagatcg
atgtcttattctgatgagtctcgactgtcgaatcttcttcggaggatcacccgggaagac
gacagagaccgaagattggctactgtaaagcagttgaaagaatttattcagcaaccagaa
aataagctggtactagttaaacaattggataatatcttggctgctgtacatgacgtgctt
aatgaaagtagcaaattgcttcaggagttgagacaggagggagcttgctgtcttggcctt
ctttgtgcttctctgagctatgaggctgagaagatcttcaagtggatttttagcaaattt
agctcatctgcaaaagatgaagttaaactcctctacttatgtgccacctacaaagcacta
gagactgtaggagaaaagaaagccttttcatctgtaatgcagcttgtaatgaccagcctg
cagtctattcttgaaaatgtggatacaccagaattgctttgtaaatgtgttaagtgcatt
cttttggtggctcgatgttaccctcatattttcagcactaattttagggatacagttgat
atattagttggatggcatatagatcatactcagaaaccttcgctcacgcagcaggtatct
gggtggttgcagagtttggagccattttgggtagctgatcttgcattttctactactctt
cttggtcagtttctggaagacatggaagcatatgctgaggacctcagccatgtggcctct
ggggaatcagtggatgaagatgtccctcctccatcagtgtcattaccaaagctggctgca
cttctccgggtatttagtactgtggtgaggagcattggggaacgcttcagcccaattcgg
ggtcctccaattactgaggcatatgtaacagatgttctgtacagagtaatgagatgtgtg
acggctgcaaaccaggtgtttttttctgaggctgtgttgacagctgctaatgagtgtgtt
ggtgttttgctcggcagcttggatcctagcatgactatacattgtgacatggtcattaca
tatggattagaccaactggagaattgccagacttgtggtaccgattatatcatctcagtc
ttgaatttactcacgctgattgttgaacagataaatacgaaactgccatcatcatttgta
gaaaaactgtttataccatcatctaaactactattcttgcgttatcataaagaaaaagag
gttgttgctgtagcccatgctgtttatcaagcagtgctcagcttgaagaatattcctgtt
ttggagactgcctataagttaatattgggagaaatgacttgtgccctaaacaacctccta
cacagtctacaacttcctgaggcctgttctgaaataaaacatgaggcttttaagaatcat
gtgttcaatgtagacaatgcaaaatttgtagttatatttgacctcagtgccctgactaca
attggaaatgccaaaaactcactaatagggatgtgggcgctatctccaactgtctttgca
cttctgagtaagaatctgatgattgtgcacagtgacctggctgttcacttccctgccatt
cagtatgctgtgctctacacattgtattctcattgtaccaggcatgatcactttatctct
agtagcctcagttcttcctctccttctttgtttgatggagctgtgattagcactgtaact
acggctacaaagaaacatttctcaattatattaaatcttctgggaatattacttaagaaa
gataaccttaaccaggacacgaggaaactgttaatgacttgggctttggaagcagctgtt
ttaatgaagaagtctgaaacatacgcacctttattctctcttccgtctttccataaattt
tgcaaaggccttttagccaacactctcgttgaagatgtgaatatctgtctgcaggcatgc
agcagtctacatgctctgtcctcttccttgccagatgatcttttacagagatgtgtcgat
gtttgccgtgttcaactagtgcacagtggaactcgtattcgacaagcatttggaaaactg
ttgaaatcaattcctttagatgttgtcctaagcaataacaatcacacagaaattcaagaa
atttctttagcattaagaagtcacatgagtaaagcaccaagtaatacattccacccccaa
gatttctctgatgttattagttttattttgtatgggaactctcatagaacagggaaggac
aattggttggaaagactgttctatagctgccagagactggataagcgtgaccagtcaaca
attccacgcaatctcctgaagacagatgctgtcctttggcagtgggccatatgggaagct
gcacaattcactgttctttctaagctgagaaccccactgggcagagctcaagacaccttc
cagacaattgaaggtatcattcgaagtctcgcagctcacacattaaaccctgatcaggat
gttagtcagtggacaactgcagacaatgatgaaggccatggtaacaaccaacttagactt
gttcttcttctgcagtatctggaaaatctggagaaattaatgtataatgcatacgaggga
tgtgctaatgcattaacttcacctcccaaggtcattagaacttttttctataccaatcgc
caaacttgtcaggactggctaacgcggattcgactctccatcatgagggtaggattgttg
gcaggccagcctgcagtgacagtgagacatggctttgacttgcttacagagatgaaaaca
accagcctatctcaggggaatgaattggaagtaaccattatgatggtggtagaagcatta
tgtgaacttcattgtcctgaagctatacagggaattgctgtctggtcatcatctattgtt
ggaaaaaatcttctgtggattaactcagtggctcaacaggctgaagggaggtttgaaaag
gcctctgtggagtaccaggaacacctgtgtgccatgacaggtgttgattgctgcatctcc
agctttgacaaatcggtgctcaccttagccaatgctgggcgtaacagtgccagcccgaaa
cattctctgaatggtgaatccagaaaaactgtgctgtccaaaccgactgactcttcccct
gaggttataaattatttaggaaataaagcatgtgagtgctacatctcaattgccgattgg
gctgctgtgcaggaatggcagaacgctatccatgacttgaaaaagagtaccagtagcact
tccctcaacctgaaagctgacttcaactatataaaatcattaagcagctttgagtctgga
aaatttgttgaatgtaccgagcagttagaattgttaccaggagaaaatatcaatctactt
gctggaggatcaaaagaaaaaatagacatgaaaaaactgcttcctaacatgttaagtccg
gatccgagggaacttcagaaatccattgaagttcaattgttaagaagttctgtttgtttg
gcaactgctttaaacccgatagaacaagatcagaagtggcagtctataactgaaaatgtg
gtaaagtacttgaagcaaacatcccgcatcgctattggacctctgagactttctacttta
acagtttcacagtctttgccagttctaagtaccttgcagctgtattgctcatctgctttg
gagaacacagtttctaacagactttcaacagaggactgtcttattccactcttcagtgaa
gctttacgttcatgtaaacagcatgacgtgaggccatggatgcaggcattaaggtatact
atgtaccagaatcagttgttggagaaaattaaagaacaaacagtcccaattagaagccat
ctcatggaattaggtctaacagcagcaaaatttgctagaaaacgagggaatgtgtccctt
gcaacaagactgctggcacagtgcagtgaagttcagctgggaaagaccaccactgcacag
gatttagtccaacattttaaaaaactatcaacccaaggtcaagtggatgaaaaatggggg
cccgaacttgatattgaaaaaaccaaattgctttatacagcaggccagtcaacacatgca
atggaaatgttgagttcttgtgccatatctttctgcaagtctgtgaaagctgaatatgca
gttgctaaatcaattctgacactggctaaatggatccaggcagaatggaaagagatttca
ggacagctgaaacaggtttacagagctcagcaccaacagaacttcacaggtctttctact
ttgtctaaaaacatactcactctaatagaactgccatctgttaatacgatggaagaagag
tatcctcggatcgagagtgaatctacagtgcatattggagttggagaacctgacttcatt
ttgggacagttgtatcacctgtcttcagtacaggcacctgaagtagccaaatcttgggca
gcgttggccagctgggcttataggtggggcagaaaggtggttgacaatgccagtcaggga
gaaggtgttcgtctgctgcctagagaaaaatctgaagttcagaatctacttccagacact
ataactgaggaagagaaagagagaatatatggtattcttggacaggctgtgtgtcggccg
gcggggattcaggatgaagatataacacttcagataactgagagtgaagacaacgaagaa
gatgacatggttgatgttatctggcgtcagttgatatcaagctgcccatggctttcagaa
cttgatgaaagtgcaactgaaggagttattaaagtgtggaggaaagttgtagatagaata
ttcagcctgtacaaactctcttgcagtgcatactttactttccttaaactcaacgctggt
caaattcctttagatgaggatgaccctaggctgcatttaagtcacagagtggaacagagc
actgatgacatgattgtgatggccacattgcgcctgctgcggttgctcgtgaagcatgct
ggtgagcttcggcagtatctggagcacggcttggagacaacacccactgcaccatggaga
ggaattattccgcaacttttctcacgcttaaaccaccctgaagtgtatgtgcgccaaagt
atttgtaaccttctctgccgtgtggctcaagattccccacatctcatattgtatcctgca
atagtgggtaccatatcgcttagtagtgaatcccaggcttcaggaaataaattttccact
gcaattccaactttacttggcaatattcaaggagaagaattgctggtttctgaatgtgag
ggaggaagtcctcctgcatctcaggatagcaataaggatgaacctaaaagtggattaaat
gaagaccaagccatgatgcaggattgttacagcaaaattgtagataagctgtcctctgca
aaccccaccatggtattacaggttcagatgctcgtggctgaactgcgcagggtcactgtg
ctctgggatgagctctggctgggagttttgctgcaacaacacatgtatgtcctgagacga
attcagcagcttgaagatgaggtgaagagagtccagaacaacaacaccttacgcaaagaa
gagaaaattgcaatcatgagggagaagcacacagctttgatgaagcccatcgtatttgct
ttggagcatgtgaggagtatcacagcggctcctgcagaaacacctcatgaaaaatggttt
caggataactatggtgatgccattgaaaatgccctagaaaaactgaagactccattgaac
cctgcaaagcctgggagcagctggattccatttaaagagataatgctaagtttgcaacag
agagcacagaaacgtgcaagttacatcttgcgtcttgaagaaatcagtccatggttggct
gccatgactaacactgaaattgctcttcctggggaagtctcagccagagacactgtcaca
atccatagtgtgggcggaaccatcacaatcttaccgactaaaaccaagccaaagaaactt
ctctttcttggatcagatgggaagagctatccttatcttttcaaaggactggaggattta
catctggatgagagaataatgcagttcctatctattgtgaataccatgtttgctacaatt
aatcgccaagaaacaccccggttccatgctcgacactattctgtaacaccactaggaaca
agatcaggactaatccagtgggtagatggagccacacccttatttggtctttacaaacga
tggcaacaacgggaagctgccttacaagcacaaaaggcccaagattcctaccaaactcct
cagaatcctggaattgtaccccgtcctagtgaactttattacagtaaaattggccctgct
ttgaaaacagttgggcttagcctggatgtgtcccgtcgggattggcctcttcatgtaatg
aaggcagtattggaagagttaatggaggccacacccccgaatctccttgccaaagagctc
tggtcatcttgcacaacacctgatgaatggtggagagttacgcagtcttatgcaagatct
actgcagtcatgtctatggttggatacataattggccttggagacagacatctggataat
gttcttatagatatgacgactggagaagttgttcacatagattacaatgtttgctttgaa
aaaggtaaaagccttagagttcctgagaaagtaccttttcgaatgacacaaaacattgaa
acagcactgggtgtaactggagtagaaggtgtatttaggctttcatgtgagcaggtttta
cacattatgcggcgtggcagagagaccctgctgacgctgctggaggcctttgtgtacgac
cctctggtggactggacagcaggaggcgaggctgggtttgctggtgctgtctatggtgga
ggtggccagcaggccgagagcaagcagagcaagagagagatggagcgagagatcacccgc
agcctgttttcttctagagtagctgagattaaggtgaactggtttaagaatagagatgag
atgctggttgtgcttcccaagttggacggtagcttagatgaatacctaagcttgcaagag
caactgacagatgtggaaaaactgcagggcaaactactggaggaaatagagtttctagaa
ggagctgaaggggtggatcatccttctcatactctgcaacacaggtattctgagcacacc
caactacagactcagcaaagagctgttcaggaagcaatccaggtgaagctgaatgaattt
gaacaatggataacacattatcaggctgcattcaataatttagaagcaacacagcttgca
agcttgcttcaagagataagcacacaaatggaccttggtcctccaagttacgtgccagca
acagcctttctgcagaatgctggtcaggcccacttgattagccagtgcgagcagctggag
ggggaggttggtgctctcctgcagcagaggcgctccgtgctccgtggctgtctggagcaa
ctgcatcactatgcaaccgtggccctgcagtatccgaaggccatatttcagaaacatcga
attgaacagtggaagacctggatggaagagctcatctgtaacaccacagtagagcgttgt
caagagctctataggaaatatgaaatgcaatatgctccccagccacccccaacagtgtgt
cagttcatcactgccactgaaatgaccctgcagcgatacgcagcagacatcaacagcaga
cttattagacaagtggaacgcttgaaacaggaagctgtcactgtgccagtttgtgaagat
cagttgaaagaaattgaacgttgcattaaagttttccttcatgagaatggagaagaagga
tctttgagtctagcaagtgttattatttctgccctttgtacccttacaaggcgtaacctg
atgatggaaggtgcagcgtcaagtgctggagaacagctggttgatctgacttctcgggat
ggagcctggttcttggaggaactctgcagtatgagcggaaacgtcacctgcttggttcag
ttactgaagcagtgccacctggtgccacaggacttagatatcccgaaccccatggaagcg
tctgagacagttcacttagccaatggagtgtatacctcacttcaggaattgaattcgaat
ttccggcaaatcatatttccagaagcacttcgatgtttaatgaaaggggaatacacgtta
gaaagtatgctgcatgaactggacggtcttattgagcagaccaccgatggcgttcccctg
cagactctagtggaatctcttcaggcctacttaagaaacgcagctatgggactggaagaa
gaaacacatgctcattacatcgatgttgccagactactacatgctcagtacggtgaatta
atccaaccgagaaatggttcagttgatgaaacacccaaaatgtcagctggccagatgctt
ttggtagcattcgatggcatgtttgctcaagttgaaactgctttcagcttattagttgaa
aagttgaacaagatggaaattcccatagcttggcgaaagattgacatcataagggaagcc
aggagtactcaagttaatttttttgatgatgataatcaccggcaggtgctagaagagatt
ttctttctaaaaagactacagactattaaggagttcttcaggctctgtggtaccttttct
aaaacattgtcaggatcaagttcacttgaagatcagaatactgtgaatgggcctgtacag
attgtcaatgtgaaaaccctttttagaaactcttgtttcagtgaagaccaaatggccaaa
cctatcaaggcattcacagctgactttgtgaggcagctcttgatagggctacccaaccaa
gccctcggactcacactgtgcagttttatcagtgctctgggtgtagacatcattgctcaa
gtagaggcaaaggactttggtgccgaaagcaaagtttctgttgatgatctctgtaagaaa
gcggtggaacataacatccagatagggaagttctctcagctggttatgaacagggcaact
gtgttagcaagttcttacgacactgcctggaagaagcatgacttggtgcgaaggctagaa
accagtatttcttcttgtaagacaagcctgcagcgggttcagctgcatattgccatgttt
cagtggcaacatgaagatctacttatcaatagaccacaagccatgtcagtcacacctccc
ccacggtctgctatcctaaccagcatgaaaaagaagctgcataccctgagccagattgaa
acttctattgcaacagttcaggagaagctagctgcacttgaatcaagtattgaacagcga
ctcaagtgggcaggtggtgccaaccctgcattggcccctgtactacaagattttgaagca
acgatagctgaaagaagaaatcttgtccttaaagagagccaaagagcaagtcaggtcaca
tttctctgcagcaatatcattcattttgaaagtttacgaacaagaactgcagaagcctta
aacctggatgcggcgttatttgaactaatcaagcgatgtcagcagatgtgttcgtttgca
tcacagtttaacagttcagtgtctgagttagagcttcgtttattacagagagtggacact
ggtcttgaacatcctattggcagctctgaatggcttttgtcagcacacaaacagttgacc
caggatatgtctactcagagggcaattcagacagagaaagagcagcagatagaaacggtc
tgtgaaacaattcagaatctggttgataatataaagactgtgctcactggtcataaccga
cagcttggagatgtcaaacatctcttgaaagctatggctaaggatgaagaagctgctctg
gcagatggtgaagatgttccctatgagaacagtgttaggcagtttttgggtgaatataaa
tcatggcaagacaacattcaaacagttctatttacattagtccaggctatgggtcaggtt
cgaagtcaagaacacgttgaaatgctccaggaaatcactcccaccttgaaagaactgaaa
acacaaagtcagagtatctataataatttagtgagttttgcatcacccttagtcaccgat
gcaacaaatgaatgttcgagtccaacgtcatctgctacttatcagccatccttcgctgca
gcagtccggagtaacactggccagaagactcagcctgatgtcatgtcacagaatgctaga
aagctgatccagaaaaatcttgctacatcagctgatactccaccaagcaccgttccagga
actggcaagagtgttgcttgtagtcctaaaaaggcagtcagagaccctaaaactgggaaa
gcggtgcaagagagaaactcctatgcagtgagtgtgtggaagagagtgaaagccaagtta
gagggccgagatgttgatccgaataggaggatgtcagttgctgaacaggttgactatgtc
attaaggaagcaactaatctagataacttggctcagctgtatgaaggttggacagcctgg
gtgtga

DBGET integrated database retrieval system