KEGG   Homo sapiens (human): 23067Help
Entry
23067             CDS       T01001                                 

Gene name
SETD1B, KMT2G, Set1B
Definition
SET domain containing 1B (EC:2.1.1.43)
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    23067 (SETD1B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     23067 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.31
AA seq 1923 aa AA seqDB search
MENSHPPHHHHQQPPPQPGPSGERRNHHWRSYKLMIDPALKKGHHKLYRYDGQHFSLAMS
SNRPVEIVEDPRVVGIWTKNKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNIRENFLR
DMCKKYGEVEEVEILYNPKTKKHLGIAKVVFATVRGAKDAVQHLHSTSVMGNIIHVELDT
KGETRMRFYELLVTGRYTPQTLPVGELDAVSPIVNETLQLSDALKRLKDGGLSAGCGSGS
SSVTPNSGGTPFSQDTAYSSCRLDTPNSYGQGTPLTPRLGTPFSQDSSYSSRQPTPSYLF
SQDPAVTFKARRHESKFTDAYNRRHEHHYVHNSPAVTAVAGATAAFRGSSDLPFGAVGGT
GGSSGPPFKAQPQDSATFAHTPPPAQATPAPGFKSAFSPYQTPVAHFPPPPEEPTATAAF
GARDSGEFRRAPAPPPLPPAEPLAKEKPGTPPGPPPPDTNSMELGGRPTFGWSPEPCDSP
GTPTLESSPAGPEKPHDSLDSRIEMLLKEQRTKLLFLREPDSDTELQMEGSPISSSSSQL
SPLAPFGTNSQPGFRGPTPPSSRPSSTGLEDISPTPLPDSDEDEELDLGLGPRPPPEPGP
PDPAGLLSQTAEVALDLVGDRTPTSEKMDEGQQSSGEDMEISDDEMPSAPITSADCPKPM
VVTPGAAAVAAPSVLAPTLPLPPPPGFPPLPPPPPPPPPQPGFPMPPPLPPPPPPPPPAH
PAVTVPPPPLPAPPGVPPPPILPPLPPFPPGLFPVMQVDMSHVLGGQWGGMPMSFQMQTQ
VLSRLMTGQGACPYPPFMAAAAAAASAGLQFVNLPPYRGPFSLSNSGPGRGQHWPPLPKF
DPSVPPPGYMPRQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMVEVVAFRAFDEWWDKK
ERMAKASLTPVKSGEHKDEDRPKPKDRIASCLLESWGKGEGLGYEGLGLGIGLRGAIRLP
SFKVKRKEPPDTTSSGDQKRLRPSTSVDEEDEESERERDRDMADTPCELAKRDPKGVGVR
RRPARPLELDSGGEEDEKESLSEEQESTEEEEEAEEEEEEEDDDDDDSDDRDESENDDED
TALSEASEKDEGDSDEEETVSIVTSKAEATSSSESSESSEFESSSESSPSSSEDEEEVVA
REEEEEEEEEEMVAEESMASAGPEDFEQDGEEAALAPGAPAVDSLGMEEEVDIETEAVAP
EERPSMLDEPPLPVGVEEPADSREPPEEPGLSQEGAMLLSPEPPAKEVEARPPLSPERAP
EHDLEVEPEPPMMLPLPLQPPLPPPRPPRPPSPPPEPETTDASHPSVPPEPLAEDHPPHT
PGLCGSLAKSQSTETVPATPGGEPPLSGGSSGLSLSSPQVPGSPFSYPAPSPSLSSGGLP
RTPGRDFSFTPTFSEPSGPLLLPVCPLPTGRRDERSGPLASPVLLETGLPLPLPLPLPLP
LALPAVLRAQARAPTPLPPLLPAPLASCPPPMKRKPGRPRRSPPSMLSLDGPLVRPPAGA
ALGRELLLLPGQPQTPVFPSTHDPRTVTLDFRNAGIPAPPPPLPPQPPPPPPPPPVEPTK
LPFKELDNQWPSEAIPPGPRGRDEVTEEYMELAKSRGPWRRPPKKRHEDLVPPAGSPELS
PPQPLFRPRSEFEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHP
STSLSSAKKKKRDDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPADTQGMSI
PAQPHASTRAGSERRSEQRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFA
MEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARF
INHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRG
TLN
NT seq 5772 nt NT seq  +upstreamnt  +downstreamnt
atggagaacagtcaccccccccaccaccaccaccagcagcccccgccgcagcccggccct
tcgggcgagaggaggaaccaccattggagaagttacaagttgatgattgacccggctctg
aaaaaggggcatcataaactgtaccgctacgatgggcagcatttcagcctggcgatgtcc
agcaaccgcccggtggaaattgtcgaagatccccgggtcgtcgggatctggaccaaaaac
aaggagctggagctgtcggtgcccaaattcaagatcgatgagttctacgtgggcccggtg
cctccgaagcaggtgacatttgccaagctgaatgataacatccgtgaaaacttcctgagg
gacatgtgcaagaagtatggggaggtggaggaggtggagattttgtacaaccccaagacc
aagaagcacctgggcatcgccaaggtggtctttgccacggtccggggagccaaggatgcc
gttcagcacttgcacagcacttccgtcatgggcaacattatccacgtggagctggacacc
aaaggggaaacccgaatgcggttctatgaactgttggtcactggccgatacaccccccag
accctcccagtgggcgagctggacgctgtctctccaatcgtgaatgagaccctgcagctg
tcagatgccctgaagcgcctcaaggatggaggcctgtctgcaggctgtggctccggctcc
tcctctgtcacccccaatagcggtgggacacccttctcccaggacacagcttattccagc
tgccgcctggacacacccaactcctatggacagggcaccccgctcacaccgcgcctgggc
acccctttctcacaggactccagctactccagccgccagcccacaccctcatacctcttc
agccaggaccctgcagtgaccttcaaggcccggcgccacgagagcaagttcacggacgcc
tacaaccgccgccacgaacatcattatgtacacaattctcccgcggtcactgcggtggcc
ggggccacagccgctttccggggttcctcggacctcccgttcggagcagtcggcggcact
gggggcagcagcggtcccccgttcaaggctcaaccacaggattcagccacatttgcccac
actccaccacccgcccaagcaacccctgctcctggattcaagtctgctttctctccgtat
cagaccccagtggcccacttccctccacccccggaagagcccaccgccacagccgctttt
ggggcccgcgacagtggggagttccggagggcaccggcgcccccacccctgccacctgct
gagcctctggccaaggagaagccaggcacgccacccggcccgccgccccccgacaccaac
agcatggagctgggcggccggcccaccttcggctggagtcctgagccctgtgacagccct
ggcacgcccacgctggagtcgtcccctgcagggccagagaaaccccacgacagcctggac
tcgcgcatcgagatgctgctgaaggagcagcgcaccaagctgctcttcctgagggagccg
gactcggacaccgagctgcagatggagggcagccccatctcctcctcctcctcccagctc
tccccactggccccctttggcaccaactcccagccaggcttccggggccccacgcccccc
tcgtcacgcccctccagcaccggcctggaggatatcagcccaacacccctcccagactcc
gacgaggacgaggagctcgacctgggccttgggcctcggcctccacctgagccaggcccc
ccggaccctgctgggcttctgagccagacagctgaggtggccttggacctggttggagac
agaaccccgacctcagagaagatggatgagggccagcagtcctcaggcgaggacatggag
atctcggatgacgagatgccctcggcccccatcaccagcgctgactgccccaagcccatg
gtggtgaccccaggagcggcagccgtggcagccccttctgtgctagccccaaccctgccg
ctgcccccgccacctggcttccccccgctgccccccccaccaccaccacccccaccgcag
cctggcttccccatgcccccaccgctgcccccaccgccgcccccaccccctccagcccac
cctgctgtgacagtgcccccaccacccttgccagcgccgcctggagtcccgcccccaccc
atcctgccaccactgcccccctttccgccgggcctgttccctgtgatgcaggtggacatg
agccacgtgctgggtggccagtggggcggcatgcccatgtccttccagatgcaaacgcag
gtgctcagccggctgatgacgggccagggcgcctgcccctacccgcccttcatggccgct
gcggccgccgctgcctcagctgggctccagtttgtcaacctgccgccctaccggggcccc
ttctccctgagcaactccggcccaggccgcgggcagcactggccaccactgcccaagttt
gacccgtcagtgcctccaccaggctacatgccacgccaggaggacccacacaaagccacg
gtggatggcgtcctgctggtggtcctcaaagaactcaaggccatcatgaagcgtgacctg
aaccgcaagatggtggaagtggtggctttccgggcctttgacgagtggtgggacaagaag
gagcggatggccaaggcctcgctgaccccggtgaagtcgggcgagcacaaggacgaggac
aggccgaagcccaaggaccgcatcgcctcgtgcctgctggagtcatggggcaagggcgag
ggcctgggctacgagggcctgggcctgggcattgggctgcgtggggccattcgcctgccc
tccttcaaggtcaagaggaaggagccaccagacaccacctcatctggcgaccagaagcgg
ctgcggccctcgacctctgtggatgaggaagatgaagagtccgagcgagagcgagaccgg
gatatggcagacaccccctgtgagctcgccaagcgggaccccaagggcgtgggtgtgcgg
cggcggccggcgcggcctctggagctggacagtggtggggaggaggacgagaaggagtca
ttgtcggaggaacaggagagcaccgaggaggaagaggaggcggaggaggaggaggaggag
gaagatgacgacgatgacgacagtgatgaccgggacgagtctgagaacgatgacgaggac
acagccctgtcagaggcgagtgagaaggacgaaggggactcggatgaagaggagacagtg
agcattgtaacctccaaggccgaagccacgtcgtccagtgagagttccgagtcttctgag
tttgagtcaagctccgagtcctcgccctcatcctcggaggatgaggaggaggtagtggcc
agggaagaggaggaagaagaggaggaggaggagatggtggccgaggaaagcatggcttct
gcaggccctgaggactttgagcaggacggggaggaagcggctctggccccgggggcacct
gcagtggactcgttgggcatggaagaggaggtggacatcgagactgaggctgtggcccct
gaggagcggccctccatgctggacgagccccccttgcctgtgggtgttgaagagccagcg
gactccagggagccgcctgaggaaccaggcctgagccaggaaggggccatgttgctgtct
ccagagccccctgccaaggaggtggaggctcgacccccattgtcccctgagcgagctcca
gaacatgacctggaagtggagccggagccccctatgatgctccccttgccgctgcaacca
ccattgccgcccccacgaccaccccggccacccagcccaccgccggagcctgagaccaca
gatgcctcacacccatctgtccctccggagccccttgccgaggaccaccccccgcatact
ccaggcctctgtggcagcctggccaagtcgcagagcacagagacggtgccagccacacca
ggcggggagcccccgctatcagggggcagcagtggcctgtccctgagctctccgcaagtg
cccggcagccccttctcctacccagccccgtcccctagcttgagcagtgggggcctccct
cggacacctggccgggacttcagcttcacacccaccttctccgagcccagcgggcccttg
ctcctgcccgtctgcccactccccactggccgacgcgatgaacgctccgggcccctggcc
tccccggtgctcctggagacgggcctgcccctccctctgccccttcccctgcccttgccc
ttggcattgcccgccgtcttgcgggcccaggctcgtgcgcccaccccgctgccacccctg
ctgcccgcccccctggcctcttgccctcccccaatgaagaggaagccgggccggccccgg
cgatccccaccatctatgctctccttggatgggcccttggtccgaccaccagcaggggcc
gcccttggaagggaactcctgctcctgccgggccagccacagacccccgtcttccccagc
acccatgacccccggacggtgaccctggacttccggaacgcggggatcccagcccctcca
ccaccccttcccccccagccacccccacccccacctcccccacctgtagagcccaccaag
ctgccctttaaggagctagacaaccagtggccctccgaggccattcctccgggcccccgt
gggcgcgatgaggtcactgaggaatacatggagttggccaagagccgggggccgtggcgc
cggccacctaagaagcgccatgaggacctggtgccacctgcgggctcgcccgaactctcg
ccaccccagcccctcttccggccccgctcggagtttgaggagatgaccatcctgtatgac
atctggaacggtggcatcgatgaggaggacatccgcttcctgtgtgtcacctacgagcga
ctgctacagcaggacaatggcatggactggcttaacgacacgctctgggtctaccatccc
tccaccagcctctcttcagctaagaagaagaaacgggacgatggcatccgcgagcacgtg
acgggctgtgcccgcagtgagggcttctacaccatcgacaagaaggacaagctcagatac
ctcaacagcagccgtgccagcaccgatgagccccccgcagacacccagggcatgagcatc
ccagcacagccccacgcctccacccgggcaggctcggagcggcgttcggagcagcgccgc
ctgctgtcctccttcactggcagctgtgacagtgacctgctcaagttcaaccagctcaag
ttccggaagaaaaagctcaagttctgcaagagccacattcacgactggggcttgttcgcc
atggagcccatcgcggctgacgagatggtcatcgagtacgtgggccagaatatccgtcag
gtgatcgcagacatgcgggagaagcgttatgaggacgagggcatcgggagcagctacatg
ttccgggtggaccatgacaccatcatcgacgccaccaagtgcggcaacttcgcgcgcttc
atcaaccacagctgcaaccccaactgctatgccaaggtgatcacggtggagtcacagaag
aagatagtcatctactcgaagcagcacattaacgtcaatgaggagattacctatgactat
aagttccccatcgaggacgtcaagatcccctgcctctgtggctccgagaactgccggggg
accctcaactag

DBGET integrated database retrieval system