KEGG   Homo sapiens (human): 2308Help
Entry
2308              CDS       T01001                                 

Gene name
FOXO1, FKH1, FKHR, FOXO1A
Definition
forkhead box O1
Orthology
K07201  
forkhead box protein O1
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Thyroid hormone signaling pathway
Pathways in cancer
Transcriptional misregulation in cancer
Prostate cancer
Disease
H00037  
Alveolar rhabdomyosarcoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    2308 (FOXO1)
   04152 AMPK signaling pathway
    2308 (FOXO1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    2308 (FOXO1)
   04919 Thyroid hormone signaling pathway
    2308 (FOXO1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2308 (FOXO1)
   05202 Transcriptional misregulation in cancers
    2308 (FOXO1)
   05215 Prostate cancer
    2308 (FOXO1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix other regulators
    2308 (FOXO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q14.1
AA seq 655 aa AA seqDB search
MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPS
ASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHP
APPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKR
LTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLN
PEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPG
SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLP
SLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPN
YQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPV
DPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLP
HTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPS
DLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggcgcctcaggtggtggagatcgacccggacttcgagccgctgccccggccg
cgctcgtgcacctggccgctgcccaggccggagtttagccagtccaactcggccacctcc
agcccggcgccgtcgggcagcgcggctgccaaccccgacgccgcggcgggcctgccctcg
gcctcggctgccgctgtcagcgccgacttcatgagcaacctgagcttgctggaggagagc
gaggacttcccgcaggcgcccggctccgtggcggcggcggtggcggcggcggccgccgcg
gccgccaccggggggctgtgcggggacttccagggcccggaggcgggctgcctgcaccca
gcgccaccgcagcccccgccgcccgggccgctgtcgcagcacccgccggtgccccccgcc
gccgctgggccgctcgcggggcagccgcgcaagagcagctcgtcccgccgcaacgcgtgg
ggcaacctgtcctacgccgacctcatcaccaaggccatcgagagctcggcggagaagcgg
ctcacgctgtcgcagatctacgagtggatggtcaagagcgtgccctacttcaaggataag
ggtgacagcaacagctcggcgggctggaagaattcaattcgtcataatctgtccctacac
agcaagttcattcgtgtgcagaatgaaggaactggaaaaagttcttggtggatgctcaat
ccagagggtggcaagagcgggaaatctcctaggagaagagctgcatccatggacaacaac
agtaaatttgctaagagccgaagccgagctgccaagaagaaagcatctctccagtctggc
caggagggtgctggggacagccctggatcacagttttccaaatggcctgcaagccctggc
tctcacagcaatgatgactttgataactggagtacatttcgccctcgaactagctcaaat
gctagtactattagtgggagactctcacccattatgaccgaacaggatgatcttggagaa
ggggatgtgcattctatggtgtacccgccatctgccgcaaagatggcctctactttaccc
agtctgtctgagataagcaatcccgaaaacatggaaaatcttttggataatctcaacctt
ctctcatcaccaacatcattaactgtttcgacccagtcctcacctggcaccatgatgcag
cagacgccgtgctactcgtttgcgccaccaaacaccagtttgaattcacccagcccaaac
taccaaaaatatacatatggccaatccagcatgagccctttgccccagatgcctatacaa
acacttcaggacaataagtcgagttatggaggtatgagtcagtataactgtgcgcctgga
ctcttgaaggagttgctgacttctgactctcctccccataatgacattatgacaccagtt
gatcctggggtagcccagcccaacagccgggttctgggccagaacgtcatgatgggccct
aattcggtcatgtcaacctatggcagccaggcatctcataacaaaatgatgaatcccagc
tcccatacccaccctggacatgctcagcagacatctgcagttaacgggcgtcccctgccc
cacacggtaagcaccatgccccacacctcgggtatgaaccgcctgacccaagtgaagaca
cctgtacaagtgcctctgccccaccccatgcagatgagtgccctggggggctactcctcc
gtgagcagctgcaatggctatggcagaatgggccttctccaccaggagaagctcccaagt
gacttggatggcatgttcattgagcgcttagactgtgacatggaatccatcattcggaat
gacctcatggatggagatacattggattttaactttgacaatgtgttgcccaaccaaagc
ttcccacacagtgtcaagacaacgacacatagctgggtgtcaggctga

DBGET integrated database retrieval system