KEGG   Homo sapiens (human): 23096Help
Entry
23096             CDS       T01001                                 

Gene name
IQSEC2, BRAG1, MRX1
Definition
IQ motif and Sec7 domain 2
Orthology
K12495  
IQ motif and SEC7 domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Disease
H00480  
Non-syndromic X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    23096 (IQSEC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp11.22
AA seq 1488 aa AA seqDB search
MEAGSGPPGGPGSESPNRAVEYLLELNNIIESQQQLLETQRRRIEELEGQLDQLTQENRD
LREESQLHRGELHRDPHGARDSPGRESQYQNLRETQFHHRELRESQFHQAARDVGYPNRE
GAYQNREAVYRDKERDASYPLQDTTGYTARERDVAQCHLHHENPALGRERGGREAGPAHP
GREKEAGYSAAVGVGPRPPRERGQLSRGASRSSSPGAGGGHSTSTSTSPATTLQRKSDGE
NSRTVSVEGDAPGSDLSTAVDSPGSQPPYRLSQLPPSSSHMGGPPAGVGLPWAQRARLQP
ASVALRKQEEEEIKRSKALSDSYELSTDLQDKKVEMLERKYGGSFLSRRAARTIQTAFRQ
YRMNKNFERLRSSASESRMSRRIILSNMRMQFSFEEYEKAQNPAYFEGKPASLDEGAMAG
ARSHRLERGLPYGGSCGGGIDGGGSSVTTSGEFSNDITELEDSFSKQVKSLAESIDEALN
CHPSGPMSEEPGSAQLEKRESKEQQEDSSATSFSDLPLYLDDTVPQQSPERLPSTEPPPQ
GRPEFWAPAPLPPVPPPVPSGTREDGSREEGTRRGPGCLECRDFRLRAAHLPLLTIEPPS
DSSVDLSDRSDRGSVHRQLVYEADGCSPHGTLKHKGPPGRAPIPHRHYPAPEGPAPAPPG
PLPPAPNSGTGPSGVAGGRRLGKCEAAGENSDGGDNESLESSSNSNETINCSSGSSSRDS
LREPPATGLCKQTYQRETRHSWDSPAFNNDVVQRRHYRIGLNLFNKKPEKGIQYLIERGF
LSDTPVGVAHFILERKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSSMDLDDALRKF
QSHIRVQGEAQKVERLIEAFSQRYCVCNPALVRQFRNPDTIFILAFAIILLNTDMYSPSV
KAERKMKLDDFIKNLRGVDNGEDIPRDLLVGIYQRIQGRELRTNDDHVSQVQAVERMIVG
KKPVLSLPHRRLVCCCQLYEVPDPNRPQRLGLHQREVFLFNDLLVVTKIFQKKKILVTYS
FRQSFPLVEMHMQLFQNSYYQFGIKLLSAVPGGERKVLIIFNAPSLQDRLRFTSDLRESI
AEVQEMEKYRVESELEKQKGMMRPNASQPGGAKDSVNGTMARSSLEDTYGAGDGLKRGAL
SSSLRDLSDAGKRGRRNSVGSLDSTIEGSVISSPRPHQRMPPPPPPPPPEEYKSQRPVSN
SSSFLGSLFGSKRGKGPFQMPPPPTGQASASSSSASSTHHHHHHHHHGHSHGGLGVLPDG
QSKLQALHAQYCQGPGPAPPPYLPPQQPSLPPPPQQPPPLPQLGSIPPPPASAPPVGPHR
HFHAHGPVPGPQHYTLGRPGRAPRRGAGGHPQFAPHGRHPLHQPTSPLPLYSPAPQHPPA
HKQGPKHFIFSHHPQMMPAAGAAGGPGSRPPGGSYSHPHHPQSPLSPHSPIPPHPSYPPL
PPPSPHTPHSPLPPTSPHGPLHASGPPGTANPPSANPKAKPSRISTVV
NT seq 4467 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggggtcggggcccccgggcggcccgggatccgagagcccaaatcgggccgtg
gagtacctgctggagctgaacaacatcatcgagagccagcagcagctgctggaaacccag
cggcggcgcatcgaggagctggagggccagctggaccagctcacccaggagaaccgcgac
ctgcgagaggagagccagctgcaccgcggggagctgcaccgggacccccacggcgcgcgg
gatagcccgggccgcgagagccagtaccagaacctgcgcgagacccagttccaccaccgc
gagctgcgggagagccagttccaccaggcggcccgggacgtgggctacccgaaccgggaa
ggcgcctaccagaatcgggaggctgtgtatcgggacaaggagcgggacgcctcctacccg
ctccaggacactaccggttacacagcccgcgagcgtgacgtggcccagtgccacctgcac
cacgagaacccagccctgggtcgcgagcgtggcgggcgggaggccgggccggcgcacccg
ggccgcgagaaggaagcgggctattcggcggcggtgggcgtggggccgcggccaccgcgg
gagcggggccagctgagccgtggcgcatccaggagctccagtcccggcgccggcggaggc
cacagcaccagtaccagcaccagcccggccacgaccctccagagaaaatctgatggtgag
aattccagaacagtcagtgtggagggtgatgccccaggcagtgacctgagcacagcggtt
gatagtcctgggagccaacccccctaccggctgagccagctgcccccctccagcagccac
atggggggcccccctgctggagtgggccttccctgggctcagcgggcacgcctccagcca
gccagtgtcgccctgaggaagcaggaggaggaggagataaagcgctccaaggccctatcg
gacagctatgaactctccacagacctgcaggacaagaaggtggaaatgctggagaggaag
tatgggggctccttcctgagccgcagggctgccaggaccatccagacagccttccgccag
taccgcatgaacaagaactttgagcggctacgcagctcagcctcagagagccgcatgtcc
cgccgcatcatcctttccaacatgcggatgcagttctcctttgaggagtatgagaaggca
cagaaccccgcgtacttcgagggcaagcctgcctcgctggacgagggtgccatggctggt
gcccggagccaccggcttgaacgggggctcccatatggaggctcctgtggtgggggcatc
gatggtggtggaagctccgtcaccacatctggagagttttctaatgacatcacagaactt
gaggactccttctccaaacaggtaaagtctctggctgaatccatcgacgaagccctgaac
tgccacccgtcagggcccatgtctgaggagccagggtcagcccagctggagaagcgggag
tcaaaggaacagcaagaggacagctcagccacatccttcagtgatcttcccctctacctg
gatgacacagttccccaacaatcccctgagcgactgcccagcacagaacccccaccccag
ggccggcccgagttctgggcgccagcccctctcccgccagttcctccaccagtgccatca
ggaacccgggaagacggtagccgtgaggaaggcactcgcaggggtcccgggtgcttggag
tgccgggatttccggctgcgggctgcccaccttcccctgcttaccattgagcctcctagt
gacagctccgtggacctgagtgaccgctcagatcgcggctctgtccaccgccagctggtg
tatgaggctgatggctgcagcccccatgggaccctgaagcacaaggggccaccaggcagg
gccccgatcccacaccgccactacccagcccctgaaggcccagccccagccccaccaggg
cccctgccaccagcccccaacagtggcactgggcccagtggtgtggctgggggtcggagg
ttggggaagtgcgaggcagcaggcgagaactctgatggtggagataacgagagccttgag
agctccagcaattccaatgagaccatcaactgcagctccggctcctcttctcgggacagt
ctaagggagcctccggctaccggcctgtgcaagcagacttaccagcgggagacaaggcat
agctgggactcgccagctttcaacaatgatgtggtccagaggcggcactaccgaatcggc
ctcaacctcttcaacaagaagccagagaagggtatccagtatctgatcgagcggggcttc
ctgtcagacacaccggtgggagtggctcacttcatcctggagcggaaaggcctcagccgg
cagatgataggggaattcctagggaaccggcagaagcagttcaacagagacgtgttggac
tgtgtggtggatgagatggacttctcctccatggatctggatgatgcgctccggaagttc
cagtcccatatccgggttcagggtgaggcccagaaagtggagcgactcatcgaagccttc
agccagcggtactgtgtctgtaacccagccctcgtgcgccagttccggaacccagacacc
atcttcatccttgcttttgccatcatcctcctcaataccgacatgtacagtcccagcgtc
aaagctgaacgaaagatgaaactagatgacttcatcaagaacctgagaggggttgacaat
ggtgaagacatcccccgagacctcctggtgggcatctaccagcgcatccaggggcgtgaa
ctgcggaccaacgatgaccatgtgtcccaggtgcaggctgtggagcgcatgattgttgga
aagaaaccagtcctgtctctccctcaccgtcgactggtttgctgctgccagctctacgag
gtgccagatccaaaccgcccccagaggctagggttgcatcagcgggaggtcttcctcttc
aatgatctccttgtggtcaccaaaattttccagaagaagaagatcttggtgacgtacagt
ttccgtcagtctttccccctcgtggaaatgcacatgcagctcttccagaattcatattac
cagtttgggatcaagttgctgtctgcagtacctggtggggagcgaaaagtcctcatcatc
ttcaatgcccccagcctccaggaccggctgcgctttacatccgacctgcgcgagtccatt
gcggaggtgcaggagatggagaaataccgtgtggagtcggagctggagaagcagaaaggt
atgatgcggcctaacgcctcacagcctggaggggccaaggactcagtgaatgggacgatg
gcccgcagtagcctggaggacacttacggggcaggcgatgggctcaaacggggcgcactc
agcagttccctgcgagacctctctgatgcagggaagcgggggcggcgtaacagcgtggga
tcgctggacagcaccatcgaagggtctgttattagcagtccacgccctcaccagaggatg
ccacctccgcccccacccccgccgccagaggagtacaagagccagaggcccgtctccaac
tcctcatccttcctgggctccctatttggaagcaagcggggcaaggggcccttccagatg
ccaccaccgccaacaggccaggcctctgcctcctcttcatctgcttcttccacgcaccac
caccaccaccaccaccatcatggccatagccacggtggcctgggggtgctgcctgatggg
cagtccaagctccaggccctgcatgcccagtattgccaaggaccgggccctgccccgcca
ccctacctcccaccccagcagccctctcttcccccacctccccagcagcccccacccttg
ccccagctgggctccattccaccgcctcccgcctcagccccacctgtggggccacatcgc
cacttccacgcccatggcccagtcccagggccccaacactataccttgggccggccaggc
agggcacccagacggggggctggaggacaccctcagtttgctccacatggccgccacccc
ctgcaccagcccacatccccactgcccctgtacagtcctgccccccagcaccctccagcc
cacaaacagggccctaagcacttcatcttcagccaccacccacagatgatgccagcagca
ggcgcggctgggggccctggatcccggccaccagggggctcctactcccacccccaccac
ccccagtcaccattgtcaccacactcacccatcccaccccacccctcctatccacccctc
cccccaccctcccctcacaccccgcactcaccccttccacccacctccccccatggcccg
ctgcacgcctctgggccccctggcacagccaacccccccagtgcaaaccccaaggccaag
ccaagccggatcagcaccgtggtctga

DBGET integrated database retrieval system