KEGG   Homo sapiens (human): 23099Help
Entry
23099             CDS       T01001                                 

Gene name
ZBTB43, ZBTB22B, ZNF-X, ZNF297B
Definition
(RefSeq) zinc finger and BTB domain containing 43
  KO
K10514  
zinc finger and BTB domain-containing protein 43
Organism
hsa  Homo sapiens (human)
Brite
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Target recognizing subunit (BTB)
     23099 (ZBTB43)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q33.3
AA seq 467 aa AA seqDB search
MEPGTNSFRVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGHIFRAHKAVLAASSPYFCD
QVLLKNSRRIVLPDVMNPRVFENILLSSYTGRLVMPAPEIVSYLTAASFLQMWHVVDKCT
EVLEGNPTVLCQKLNHGSDHQSPSSSSYNGLVESFELGSGGHTDFPKAQELRDGENEEES
TKDELSSQLTEHEYLPSNSSTEHDRLSTEMASQDGEEGASDSAEFHYTRPMYSKPSIMAH
KRWIHVKPERLEQACEGMDVHATYDEHQVTESINTVQTEHTVQPSGVEEDFHIGEKKVEA
EFDEQADESNYDEQVDFYGSSMEEFSGERSDGNLIGHRQEAALAAGYSENIEMVTGIKEE
ASHLGFSATDKLYPCQCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMK
IHTGIKPYECNICAKRFMWRDSFHRHVTSCTKSYEAAKAEQNTTEAN
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggagcctggaacaaactcttttcgggtagaatttcctgatttttccagcaccattcta
cagaaactgaaccagcagcgccagcaaggacaattatgtgacgtctccattgttgtccaa
ggccacattttccgggcacacaaagccgttcttgctgccagttcaccctacttttgtgac
caggtactcctgaaaaacagcaggagaattgttttgcctgatgtgatgaacccaagagtg
tttgagaacattctcctatctagttatacaggacgtctagtaatgcccgctccagaaatt
gttagttacttgacagcggcaagcttcctccagatgtggcatgtggtagacaaatgcact
gaagttttagagggaaaccctacagtcctttgtcagaagctaaatcatggcagtgaccac
cagtcaccaagcagcagtagttataatggcctggtagagagctttgagctgggctctggg
ggtcatactgattttcccaaagcccaagaactgagagatggtgaaaatgaagaggagagc
accaaagacgagctgtcatcccagctcaccgagcacgaatacctgcccagcaactcgtcc
acagagcatgaccgcctgagcacggaaatggcaagccaggatggggaggagggcgccagc
gacagcgccgagttccactacacccggcccatgtacagcaagcccagcatcatggctcac
aaacgctggatccacgtgaagcccgagcgcttagaacaggcttgcgagggcatggatgtg
cacgcgacctacgacgagcaccaggtcacagagtccatcaacaccgtgcagacagagcac
acggtgcagccttcgggagtggaggaggacttccacatcggggagaagaaagtggaagct
gagtttgatgaacaggctgatgaaagcaattatgatgagcaggtggatttctatggctct
tccatggaagagttttccggagagaggtcagatgggaatctaattgggcacagacaggag
gctgccctcgcagcaggttacagtgagaatattgaaatggtaacagggattaaagaagaa
gcttcccacttaggattctcagccactgacaagctgtatccttgtcagtgtgggaaaagt
ttcactcacaagagtcagagagatcggcacatgagcatgcacctcggtcttcggccttac
ggctgtggggtctgcggtaagaaattcaaaatgaagcaccatctcgtgggccacatgaaa
attcacacaggcataaagccgtatgagtgtaatatctgtgcaaagaggtttatgtggagg
gacagtttccaccggcatgtgacttcttgtactaagtcctacgaagctgcaaaggctgag
cagaatacaactgaggctaactaa

DBGET integrated database retrieval system