KEGG   Homo sapiens (human): 231Help
Entry
231               CDS       T01001                                 

Gene name
AKR1B1, ADR, ALDR1, ALR2, AR
Definition
(RefSeq) aldo-keto reductase family 1, member B1 (aldose reductase) (EC:1.1.1.21)
  KO
K00011  
aldehyde reductase [EC:1.1.1.21]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Galactose metabolism
Glycerolipid metabolism
Metabolic pathways
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    231 (AKR1B1)
   00051 Fructose and mannose metabolism
    231 (AKR1B1)
   00052 Galactose metabolism
    231 (AKR1B1)
  Lipid metabolism
   00561 Glycerolipid metabolism
    231 (AKR1B1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.21  aldehyde reductase
     231 (AKR1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q35
AA seq 316 aa AA seqDB search
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK
EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcaagccgtctcctgctcaacaacggcgccaagatgcccatcctggggttgggtacc
tggaagtcccctccagggcaggtgactgaggccgtgaaggtggccattgacgtcgggtac
cgccacatcgactgtgcccatgtgtaccagaatgagaatgaggtgggggtggccattcag
gagaagctcagggagcaggtggtgaagcgtgaggagctcttcatcgtcagcaagctgtgg
tgcacgtaccatgagaagggcctggtgaaaggagcctgccagaagacactcagcgacctg
aagctggactacctggacctctaccttattcactggccgactggctttaagcctgggaag
gaatttttcccattggatgagtcgggcaatgtggttcccagtgacaccaacattctggac
acgtgggcggccatggaagagctggtggatgaagggctggtgaaagctattggcatctcc
aacttcaaccatctccaggtggagatgatcttaaacaaacctggcttgaagtataagcct
gcagttaaccagattgagtgccacccatatctcactcaggagaagttaatccagtactgc
cagtccaaaggcatcgtggtgaccgcctacagccccctcggctctcctgacaggccctgg
gccaagcccgaggacccttctctcctggaggatcccaggatcaaggcgatcgcagccaag
cacaataaaactacagcccaggtcctgatccggttccccatgcagaggaacttggtggtg
atccccaagtctgtgacaccagaacgcattgctgagaactttaaggtctttgactttgaa
ctgagcagccaggatatgaccaccttactcagctacaacaggaactggagggtctgtgcc
ttgttgagctgtacctcccacaaggattaccccttccatgaagagttttga

DBGET integrated database retrieval system