KEGG   Homo sapiens (human): 231Help
Entry
231               CDS       T01001                                 

Gene name
AKR1B1, ADR, ALDR1, ALR2, AR
Definition
(RefSeq) aldo-keto reductase family 1 member B
  KO
K00011  
aldehyde reductase [EC:1.1.1.21]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Galactose metabolism
Glycerolipid metabolism
Folate biosynthesis
Metabolic pathways
Drug target
Alrestatin sodium: 
Epalrestat: 
Fidarestat: 
Lidorestat: 
Minalrestat: 
Ponalrestat: 
Ranirestat: 
Risarestat: 
Sorbinil: 
Tolrestat: 
Zenarestat: 
Zopolrestat: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    231 (AKR1B1)
   00051 Fructose and mannose metabolism
    231 (AKR1B1)
   00052 Galactose metabolism
    231 (AKR1B1)
  Lipid metabolism
   00561 Glycerolipid metabolism
    231 (AKR1B1)
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    231 (AKR1B1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.21  aldehyde reductase
     231 (AKR1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P15121(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
7q33
AA seq 316 aa AA seqDB search
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK
EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcaagccgtctcctgctcaacaacggcgccaagatgcccatcctggggttgggtacc
tggaagtcccctccagggcaggtgactgaggccgtgaaggtggccattgacgtcgggtac
cgccacatcgactgtgcccatgtgtaccagaatgagaatgaggtgggggtggccattcag
gagaagctcagggagcaggtggtgaagcgtgaggagctcttcatcgtcagcaagctgtgg
tgcacgtaccatgagaagggcctggtgaaaggagcctgccagaagacactcagcgacctg
aagctggactacctggacctctaccttattcactggccgactggctttaagcctgggaag
gaatttttcccattggatgagtcgggcaatgtggttcccagtgacaccaacattctggac
acgtgggcggccatggaagagctggtggatgaagggctggtgaaagctattggcatctcc
aacttcaaccatctccaggtggagatgatcttaaacaaacctggcttgaagtataagcct
gcagttaaccagattgagtgccacccatatctcactcaggagaagttaatccagtactgc
cagtccaaaggcatcgtggtgaccgcctacagccccctcggctctcctgacaggccctgg
gccaagcccgaggacccttctctcctggaggatcccaggatcaaggcgatcgcagccaag
cacaataaaactacagcccaggtcctgatccggttccccatgcagaggaacttggtggtg
atccccaagtctgtgacaccagaacgcattgctgagaactttaaggtctttgactttgaa
ctgagcagccaggatatgaccaccttactcagctacaacaggaactggagggtctgtgcc
ttgttgagctgtacctcccacaaggattaccccttccatgaagagttttga

DBGET integrated database retrieval system