KEGG   Homo sapiens (human): 23118Help
Entry
23118             CDS       T01001                                 

Gene name
TAB2, CHTD2, MAP3K7IP2, TAB-2
Definition
TGF-beta activated kinase 1/MAP3K7 binding protein 2
Orthology
K04404  
TAK1-binding protein 2
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
TNF signaling pathway
Leishmaniasis
Toxoplasmosis
Measles
Herpes simplex infection
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    23118 (TAB2)
   04064 NF-kappa B signaling pathway
    23118 (TAB2)
   04668 TNF signaling pathway
    23118 (TAB2)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    23118 (TAB2)
   04621 NOD-like receptor signaling pathway
    23118 (TAB2)
  Development
   04380 Osteoclast differentiation
    23118 (TAB2)
 Human Diseases
  Infectious diseases
   05162 Measles
    23118 (TAB2)
   05168 Herpes simplex infection
    23118 (TAB2)
   05169 Epstein-Barr virus infection
    23118 (TAB2)
   05145 Toxoplasmosis
    23118 (TAB2)
   05140 Leishmaniasis
    23118 (TAB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q25.1
AA seq 693 aa AA seqDB search
MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDL
NFSDDSGISGLRNHMTSLNLDLQSQNIYHHGREGSRMNGSRTLTHSISDGQLQGGQSNSE
LFQQEPQTAPAQVPQGFNVFGMSSSSGASNSAPHLGFHLGSKGTSSLSQQTPRFNPIMVT
LAPNIQTGRNTPTSLHIHGVPPPVLNSPQGNSIYIRPYITTPGGTTRQTQQHSGWVSQFN
PMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHS
SGSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGPRTSSTSSSVNSQTL
NRNQPTVYIAASPPNTDELMSRSQPKVYISANAATGDEQVMRNQPTLFISTNSGASAASR
NMSGQVSMGPAFIHHHPPKSRAIGNNSATSPRVVVTQPNTKYTFKITVSPNKPPAVSPGV
VSPTFELTNLLNHPDHYVETENIQHLTDPTLAHVDRISETRKLSMGSDDAAYTQALLVHQ
KARMERLQRELEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNR
QLQIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQRSIIKTPKTQDT
EDDEGAQWNCTACTFLNHPALIRCEQCEMPRHF
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaggaagccaccaaattgattttcaggttttacatgacctgcgacaaaaattc
cctgaagtacctgaagttgttgtatccaggtgcatgttacagaataataataacctggat
gcctgctgtgctgttctctctcaggagagtacaagatatctttatggtgaaggagacttg
aatttttcagatgattctggaatttctggtctacgcaatcacatgacttctctcaacttg
gacttgcaatcacagaacatttaccaccatggaagagaaggaagtaggatgaatggaagt
aggactctaacgcacagcattagtgatggacaacttcaaggtggccagtccaatagtgaa
ctatttcagcaggagccacagacagcaccagctcaagttcctcaaggctttaatgttttt
ggaatgtccagttcctctggtgcttcaaattcagcaccacatcttggatttcacttaggc
agcaaaggaacatctagcctttctcaacaaactcccagatttaatcccattatggtaact
ttagccccaaatatccagactggtcgtaatactcctacatctttgcacatacatggtgta
cctccacctgtacttaacagtccacagggaaattctatctatattaggccttacattaca
actcctggtggtacaactcgacagacacaacagcattctggctgggtatctcagtttaat
cccatgaaccctcagcaagtttatcagccttcacagcctggtccctggactacttgtcct
gcatctaatcctctgtcacatacctcatctcaacagccaaatcagcaaggccaccagacc
tctcatgtctacatgccaatcagttcacctactacttcacaaccaccaaccattcattca
tctggtagctcacagtcttctgcccatagccaatataacattcagaatatttcaacagga
cctcgaaaaaaccagattgaaatcaaacttgaacccccacaaagaaataattcttcaaaa
ctgcgttcttctggacctcgaacctccagcacttcctcttcagtcaatagccagacctta
aacagaaatcagcccactgtttacatagctgccagccccccaaatacggatgagctgatg
tcccgtagtcaacctaaggtctatatttcagcgaatgctgccacaggagatgaacaggtc
atgcggaatcagcccacactcttcatatccacaaactctggagcatctgctgcctccagg
aacatgtctgggcaagtgagcatgggtcctgcctttattcatcaccatcctcccaaaagt
cgagcaataggcaataactctgcaacctctcctcgagtggtagtcactcagcccaatacg
aaatacactttcaaaattacagtctctcccaataagccccctgcagtttcaccaggggtg
gtgtcccctacctttgaacttacaaatcttcttaatcatcctgatcattatgtagaaacc
gagaatattcagcacctcacggaccctacattagcacatgtggatagaataagtgaaaca
cggaaactgagtatgggatctgatgatgctgcctacacacaagctcttttggtacaccag
aaggccagaatggaacgacttcaaagagaacttgagattcaaaagaaaaagctggataaa
ttaaaatctgaggttaatgaaatggaaaataatctaactcgaaggcgcctgaaaagatca
aattctatatcccagataccttcccttgaagaaatgcagcagctgagaagttgtaataga
caactccagattgacattgactgcttaaccaaagaaattgatctttttcaagcccgagga
ccacattttaaccccagcgctattcataacttttatgacaatattggatttgtaggtcct
gtgccaccaaaacccaaagatcaaaggtccatcatcaaaacaccaaagactcaagacaca
gaagatgatgagggagctcagtggaattgtaccgcctgtacttttttgaaccatccagcc
ttaattcgctgtgaacagtgtgagatgccaaggcatttctga

DBGET integrated database retrieval system