KEGG   Homo sapiens (human): 2312Help
Entry
2312              CDS       T01001                                 

Gene name
FLG, ATOD2
Definition
(RefSeq) filaggrin
Organism
hsa  Homo sapiens (human)
Disease
H00735  Ichthyosis vulgaris
H01358  Atopic dermatitis
SSDB OrthologParalogGFIT
Motif
Pfam: Filaggrin S_100 EF-hand_7 EF-hand_1
Motif
Other DBs
NCBI-GeneID: 2312
NCBI-ProteinID: NP_002007
OMIM: 135940
HGNC: 3748
Ensembl: ENSG00000143631
Vega: OTTHUMG00000012202
Pharos: P20930(Tbio)
UniProt: P20930
Structure
PDB: 

Jmol
Position
1q21.3
AA seq 4061 aa AA seqDB search
MSTLLENIFAIINLFKQYSKKDKNTDTLSKKELKELLEKEFRQILKNPDDPDMVDVFMDH
LDIDHNKKIDFTEFLLMVFKLAQAYYESTRKENLPISGHKHRKHSHHDKHEDNKQEENKE
NRKRPSSLERRNNRKGNKGRSKSPRETGGKRHESSSEKKERKGYSPTHREEEYGKNHHNS
SKKEKNKTENTRLGDNRKRLSERLEEKEDNEEGVYDYENTGRMTQKWIQSGHIATYYTIQ
DEAYDTTDSLLEENKIYERSRSSDGKSSSQVNRSRHENTSQVPLQESRTRKRRGSRVSQD
RDSEGHSEDSERHSGSASRNHHGSAWEQSRDGSRHPRSHDEDRASHGHSADSSRQSGTRH
AETSSRGQTASSHEQARSSPGERHGSGHQQSADSSRHSATGRGQASSAVSDRGHRGSSGS
QASDSEGHSENSDTQSVSGHGKAGLRQQSHQESTRGRSGERSGRSGSSLYQVSTHEQPDS
AHGRTGTSTGGRQGSHHEQARDSSRHSASQEGQDTIRGHPGSSRGGRQGSHHEQSVNRSG
HSGSHHSHTTSQGRSDASHGQSGSRSASRQTRNEEQSGDGTRHSGSRHHEASSQADSSRH
SQVGQGQSSGPRTSRNQGSSVSQDSDSQGHSEDSERWSGSASRNHHGSAQEQSRDGSRHP
RSHHEDRAGHGHSADSSRKSGTRHTQNSSSGQAASSHEQARSSAGERHGSRHQLQSADSS
RHSGTGHGQASSAVRDSGHRGSSGSQATDSEGHSEDSDTQSVSGHGQAGHHQQSHQESAR
DRSGERSRRSGSFLYQVSTHKQSESSHGWTGPSTGVRQGSHHEQARDNSRHSASQDGQDT
IRGHPGSSRRGRQGSHHEQSVDRSGHSGSHHSHTTSQGRSDASRGQSGSRSASRTTRNEE
QSRDGSRHSGSRHHEASSHADISRHSQAGQGQSEGSRTSRRQGSSVSQDSDSEGHSEDSE
RWSGSASRNHRGSAQEQSRHGSRHPRSHHEDRAGHGHSADSSRQSGTPHAETSSGGQAAS
SHEQARSSPGERHGSRHQQSADSSRHSGIPRRQASSAVRDSGHWGSSGSQASDSEGHSEE
SDTQSVSGHGQDGPHQQSHQESARDWSGGRSGRSGSFIYQVSTHEQSESAHGRTRTSTGR
RQGSHHEQARDSSRHSASQEGQDTIRAHPGSRRGGRQGSHHEQSVDRSGHSGSHHSHTTS
QGRSDASHGQSGSRSASRQTRKDKQSGDGSRHSGSRHHEAASWADSSRHSQVGQEQSSGS
RTSRHQGSSVSQDSDSERHSDDSERLSGSASRNHHGSSREQSRDGSRHPGFHQEDRASHG
HSADSSRQSGTHHTESSSHGQAVSSHEQARSSPGERHGSRHQQSADSSRHSGIGHRQASS
AVRDSGHRGSSGSQVTNSEGHSEDSDTQSVSAHGQAGPHQQSHKESARGQSGESSGRSRS
FLYQVSSHEQSESTHGQTAPSTGGRQGSRHEQARNSSRHSASQDGQDTIRGHPGSSRGGR
QGSYHEQSVDRSGHSGYHHSHTTPQGRSDASHGQSGPRSASRQTRNEEQSGDGSRHSGSR
HHEPSTRAGSSRHSQVGQGESAGSKTSRRQGSSVSQDRDSEGHSEDSERRSESASRNHYG
SAREQSRHGSRNPRSHQEDRASHGHSAESSRQSGTRHAETSSGGQAASSQEQARSSPGER
HGSRHQQSADSSTDSGTGRRQDSSVVGDSGNRGSSGSQASDSEGHSEESDTQSVSAHGQA
GPHQQSHQESTRGQSGERSGRSGSFLYQVSTHEQSESAHGRTGPSTGGRQRSRHEQARDS
SRHSASQEGQDTIRGHPGSSRGGRQGSHYEQSVDSSGHSGSHHSHTTSQERSDVSRGQSG
SRSVSRQTRNEKQSGDGSRHSGSRHHEASSRADSSRHSQVGQGQSSGPRTSRNQGSSVSQ
DSDSQGHSEDSERWSGSASRNHLGSAWEQSRDGSRHPGSHHEDRAGHGHSADSSRQSGTR
HTESSSRGQAASSHEQARSSAGERHGSHHQLQSADSSRHSGIGHGQASSAVRDSGHRGYS
GSQASDSEGHSEDSDTQSVSAQGKAGPHQQSHKESARGQSGESSGRSGSFLYQVSTHEQS
ESTHGQSAPSTGGRQGSHYDQAQDSSRHSASQEGQDTIRGHPGPSRGGRQGSHQEQSVDR
SGHSGSHHSHTTSQGRSDASRGQSGSRSASRKTYDKEQSGDGSRHSGSHHHEASSWADSS
RHSLVGQGQSSGPRTSRPRGSSVSQDSDSEGHSEDSERRSGSASRNHHGSAQEQSRDGSR
HPRSHHEDRAGHGHSAESSRQSGTHHAENSSGGQAASSHEQARSSAGERHGSHHQQSADS
SRHSGIGHGQASSAVRDSGHRGSSGSQASDSEGHSEDSDTQSVSAHGQAGPHQQSHQEST
RGRSAGRSGRSGSFLYQVSTHEQSESAHGRTGTSTGGRQGSHHKQARDSSRHSTSQEGQD
TIHGHPGSSSGGRQGSHYEQLVDRSGHSGSHHSHTTSQGRSDASHGHSGSRSASRQTRND
EQSGDGSRHSGSRHHEASSRADSSGHSQVGQGQSEGPRTSRNWGSSFSQDSDSQGHSEDS
ERWSGSASRNHHGSAQEQLRDGSRHPRSHQEDRAGHGHSADSSRQSGTRHTQTSSGGQAA
SSHEQARSSAGERHGSHHQQSADSSRHSGIGHGQASSAVRDSGHRGYSGSQASDNEGHSE
DSDTQSVSAHGQAGSHQQSHQESARGRSGETSGHSGSFLYQVSTHEQSESSHGWTGPSTR
GRQGSRHEQAQDSSRHSASQDGQDTIRGHPGSSRGGRQGYHHEHSVDSSGHSGSHHSHTT
SQGRSDASRGQSGSRSASRTTRNEEQSGDGSRHSGSRHHEASTHADISRHSQAVQGQSEG
SRRSRRQGSSVSQDSDSEGHSEDSERWSGSASRNHHGSAQEQLRDGSRHPRSHQEDRAGH
GHSADSSRQSGTRHTQTSSGGQAASSHEQARSSAGERHGSHHQQSADSSRHSGIGHGQAS
SAVRDSGHRGYSGSQASDNEGHSEDSDTQSVSAHGQAGSHQQSHQESARGRSGETSGHSG
SFLYQVSTHEQSESSHGWTGPSTRGRQGSRHEQAQDSSRHSASQYGQDTIRGHPGSSRGG
RQGYHHEHSVDSSGHSGSHHSHTTSQGRSDASRGQSGSRSASRTTRNEEQSGDSSRHSVS
RHHEASTHADISRHSQAVQGQSEGSRRSRRQGSSVSQDSDSEGHSEDSERWSGSASRNHR
GSVQEQSRHGSRHPRSHHEDRAGHGHSADRSRQSGTRHAETSSGGQAASSHEQARSSPGE
RHGSRHQQSADSSRHSGIPRGQASSAVRDSRHWGSSGSQASDSEGHSEESDTQSVSGHGQ
AGPHQQSHQESARDRSGGRSGRSGSFLYQVSTHEQSESAHGRTRTSTGRRQGSHHEQARD
SSRHSASQEGQDTIRGHPGSSRRGRQGSHYEQSVDRSGHSGSHHSHTTSQGRSDASRGQS
GSRSASRQTRNDEQSGDGSRHSWSHHHEASTQADSSRHSQSGQGQSAGPRTSRNQGSSVS
QDSDSQGHSEDSERWSGSASRNHRGSAQEQSRDGSRHPTSHHEDRAGHGHSAESSRQSGT
HHAENSSGGQAASSHEQARSSAGERHGSHHQQSADSSRHSGIGHGQASSAVRDSGHRGSS
GSQASDSEGHSEDSDTQSVSAHGQAGPHQQSHQESTRGRSAGRSGRSGSFLYQVSTHEQS
ESAHGRAGPSTGGRQGSRHEQARDSSRHSASQEGQDTIRGHPGSRRGGRQGSYHEQSVDR
SGHSGSHHSHTTSQGRSDASHGQSGSRSASRETRNEEQSGDGSRHSGSRHHEASTQADSS
RHSQSGQGESAGSRRSRRQGSSVSQDSDSEAYPEDSERRSESASRNHHGSSREQSRDGSR
HPGSSHRDTASHVQSSPVQSDSSTAKEHGHFSSLSQDSAYHSGIQSRGSPHSSSSYHYQS
EGTERQKGQSGLVWRHGSYGSADYDYGESGFRHSQHGSVSYNSNPVVFKERSDICKASAF
GKDHPRYYATYINKDPGLCGHSSDISKQLGFSQSQRYYYYE
NT seq 12186 nt NT seq  +upstreamnt  +downstreamnt
atgtctactctcctggaaaacatctttgccataattaatcttttcaagcaatattcaaaa
aaagataaaaacactgacacattgagtaaaaaagagctgaaggaacttctggaaaaggaa
tttcggcaaatcctgaagaatccagatgacccagatatggttgatgtcttcatggatcac
ttggatatagaccacaacaagaaaattgacttcactgagtttcttctgatggtattcaag
ttggctcaagcatattatgagtctaccagaaaagagaatttaccgatatcaggacacaag
cacagaaagcacagtcatcatgataaacatgaagataataaacaggaagaaaacaaagaa
aacagaaaaagaccctcaagtctggaaagaagaaacaatagaaaagggaataagggaaga
tccaagagcccaagagaaacaggggggaaaaggcatgaatctagttctgaaaaaaaagaa
agaaaaggatattcacctactcatagagaagaagaatatggaaaaaaccatcataactca
agtaaaaaagagaaaaacaagactgaaaatactagattaggagacaataggaagaggcta
agtgaaagacttgaagagaaagaagacaatgaagaaggagtatatgattatgaaaataca
ggaagaatgactcaaaaatggatacaatcaggccatattgccacatattacacaatccag
gatgaagcctatgacaccactgatagtctattagaagaaaacaaaatatatgaaagatca
aggtcatctgatggcaaatcatcatctcaagtgaacaggtcaagacatgaaaatacaagc
caggtaccattgcaggagtccaggacaagaaagcgtaggggatccagagttagccaggac
agggacagtgagggacactcagaagactctgagaggcactctgggtcggcttccagaaac
catcatggatctgcgtgggagcagtcaagagatggctccagacaccccaggtcccatgat
gaagacagagccagtcatgggcactctgcagacagctccagacaatcaggcactcgtcac
gcagagacttcctctcgtggacagactgcatcatcccatgaacaggcaagatcaagtcca
ggagaaagacatggatccggccaccagcagtcagcagacagctccagacactcagccact
gggcgcgggcaagcttcatctgcagtcagcgatcgtggacaccgggggtctagcggtagt
caggccagtgacagtgagggacattcagaaaactcagacacacaatcagtgtcaggccac
ggaaaggctgggctgagacagcagagccaccaagagtccacacgtggccggtcaggggaa
cggtctggacgttcagggtcttccctctaccaggtgagcactcatgaacagcctgactct
gcccatggacggaccgggaccagcactggaggaagacaaggatcgcaccacgagcaggca
cgagacagctccaggcattcagcgtcccaagagggtcaggacaccattcgtggacacccg
gggtcaagcagaggaggaaggcagggatcccaccacgagcaatcggtaaataggtctgga
cactcaggttcccatcacagccacaccacatcccagggaaggtctgatgcctcccatggg
cagtcaggatccagaagtgcaagcagacaaacacgaaatgaggaacaatcaggagacggc
accaggcactcagggtcacgtcatcatgaagcttcctctcaggctgacagctctagacac
tcacaggtgggccagggacaatcatcggggcccaggacaagtaggaaccagggatccagt
gttagccaggacagtgacagtcagggacactcagaagactctgagaggtggtctgggtct
gcttccagaaaccatcatggatctgctcaggagcagtcaagagatggctccagacacccc
aggtcccatcacgaagacagagctggtcatgggcactctgcagacagctccagaaaatca
ggcactcgtcacacacagaattcctctagtggacaggctgcgtcatcccatgaacaggca
agatcaagtgcaggagaaagacatggatcccgccaccagctccagtcagcagacagctcc
agacactcaggcactgggcacggacaagcttcatctgcagtcagagacagtggacaccga
gggtccagtggtagtcaggccactgacagtgagggacattcagaagactcagacacacag
tcagtgtcaggccatggacaggctggtcaccatcagcagagccaccaagagtccgcacgt
gaccggtcaggggaaaggtctcgacgttcagggtctttcctctaccaggtgagcactcat
aaacagtctgagtcctcccatggatggacagggcccagcactggagtaagacaaggatcc
caccatgagcaggcacgagacaactccaggcactcagcatcccaagatggtcaggacacc
attcgtggacacccggggtcaagcagaagaggaaggcaggggtcccaccacgagcaatcg
gtagataggtctggacactcagggtcccatcacagccacaccacatcccagggaaggtct
gatgcctcccgtgggcagtcaggatccagaagtgcaagcagaacaacacgtaatgaggaa
caatcaagagacggctccaggcactcagggtcacgtcaccatgaagcttcctctcatgcc
gacatctctagacactcacaggcaggccagggacaatcagaggggtccaggacaagcagg
cgccagggatccagtgttagccaggacagtgacagtgagggacattcagaagactctgag
aggtggtctgggtctgcttccagaaaccatcgtggatctgctcaggagcagtcaagacat
ggctccagacaccccaggtcccatcacgaagacagagccggtcacgggcactctgcagac
agctccagacaatcaggaactcctcacgcagagacttcctctggtggacaggctgcgtca
tcccatgaacaggcaagatcaagtccaggagaaagacacggatcccgccaccagcagtca
gcagacagctccagacactcaggcattccgcgcagacaagcttcatctgcagtcagagac
agtggacactgggggtccagtggtagtcaggccagtgatagtgagggacattcagaggag
tcagacacacagtcagtgtcaggccatggacaggatgggccccatcagcagagccaccaa
gagtccgcacgtgactggtcagggggaaggtctggacgttcagggtctttcatctaccag
gtgagcactcatgaacagtctgagtctgcccatgggcggaccaggaccagcactggacga
agacaaggatcccaccacgagcaggcacgagacagctccaggcactcagcgtcccaagag
ggtcaggacaccattcgtgcacacccggggtcaaggagaggaggaaggcagggatcccac
catgagcaatcggtagatagatctggacactcagggtcccatcacagccacaccacatcc
cagggaaggtctgatgcctcccatgggcagtcaggatccagaagtgcaagcagacaaact
cgtaaggacaaacaatcaggagacggctccaggcactcagggtcacgtcaccatgaagct
gcctcttgggctgacagctctagacactcacaggtgggacaggaacaatcatcggggtcc
aggacaagcaggcaccagggatccagtgttagccaggacagtgacagtgagagacactca
gacgactccgagaggttgtctgggtctgcttccagaaaccatcatggatcttctcgggag
cagtcaagagatggctccagacaccctgggttccatcaagaagacagagccagtcacggg
cactctgcagacagctccagacaatcaggcactcatcacacagagtcttcctctcatgga
caggctgtgtcatcccatgaacaggcaagatcaagtccaggagaaagacatggatcccgc
caccagcagtcagcagacagctccagacactcaggcattgggcacagacaagcttcatct
gcagtcagagacagtggacaccgagggtccagtggtagtcaggtcactaacagtgaggga
cattcagaagactcagacacacagtcagtgtcagcccacggacaagctgggccccatcag
cagagccacaaagagtccgcacgtggccagtcaggggaaagctctggacgttcaaggtct
ttcctctaccaggtgagctctcatgaacagtctgagtccacacacggacagactgcaccc
agcactggaggaagacaaggatcccgccatgagcaggcacgaaacagctctaggcactca
gcatcccaagacggtcaggacaccattcgtggacacccggggtcaagcagaggaggaagg
cagggatcctaccacgagcaatcagtagataggtctggacactcagggtaccatcacagc
cacaccacaccccagggaaggtctgatgcctcccatgggcagtcaggacccagaagtgca
agcaggcaaacaagaaatgaggaacaatcaggagacggctccaggcactcagggtcacgt
caccatgaaccttccactcgggccggcagctctagacactcacaggtgggccagggagaa
tcagcggggtccaagacaagcaggcgccagggatccagtgttagtcaggacagggacagt
gagggacactcagaagactctgagaggcggtctgagtcggcttccagaaaccattatgga
tctgctcgggagcagtcaagacatggctccaggaaccccaggtcccatcaagaagataga
gccagtcatgggcactctgcagagagctccagacaatcaggcactcgtcatgcagagact
tcctctggtggacaggctgcatcatcccaggaacaggcaaggtcaagtccaggagaaaga
catggatcccgccaccagcagtcagcagacagctccacagactcaggcactgggcgcaga
caagattcatctgtagtcggagacagtggaaaccgagggtccagtggtagccaggccagt
gacagcgagggacactcagaagagtcagacacacagtcagtgtcagcccacggacaggct
gggccccatcagcagagccaccaagagtccacacgtggccagtcaggggaaaggtctgga
cgttcagggtctttcctctaccaggtgagcactcatgaacagtctgagtccgcccatgga
cgcacagggcccagcactggaggaagacaaagatcccgccacgagcaggcacgagacagc
tccaggcactcagcgtcccaagagggtcaggacaccattcgtggacacccagggtcaagc
agaggaggaaggcagggatcccactatgagcaatcggtagatagttctggacactcaggg
tctcatcacagccacaccacgtcccaggaaaggtctgatgtctcccgtgggcagtcagga
tccagaagtgtcagcagacaaacacgtaatgagaaacaatcaggagacggctccaggcac
tcagggtcgcgtcaccatgaagcttcctctcgggccgacagctctagacactcgcaggtg
ggccagggacaatcatcagggcccaggacaagcaggaaccagggatccagtgttagccag
gacagtgacagtcagggacactcagaagactctgagaggtggtctgggtctgcttccaga
aaccatcttggatctgcttgggagcagtcaagagatggctccagacaccctgggtcccat
cacgaagacagagccggtcacgggcactctgcagacagctccagacaatcaggcactcgt
cacacagagtcttcctctcgtggacaggctgcgtcatcccatgaacaggcaagatcaagt
gcaggagaaagacatggatcccaccaccagctccagtcagcagacagctccagacactca
ggcattgggcatggacaagcttcatctgcagtcagagacagtggacaccgagggtacagt
ggtagtcaggccagtgacagtgagggacattcagaagactcagacacacagtcagtgtca
gcacagggaaaagctgggccccatcagcagagccacaaagagtccgcacgtggccagtca
ggggaaagctctggacgttcagggtctttcctctaccaggtgagcactcatgaacagtct
gagtccacccatggacagtctgcgcccagcactggaggaagacaaggatcccattatgat
caggcacaagacagctccaggcactcagcatcccaagagggtcaggacaccattcgtgga
cacccggggccaagcagaggaggaagacaggggtcccaccaagagcaatcggtagatagg
tctggacactcagggtctcatcacagccacaccacatcccagggaaggtctgatgcctcc
cgtgggcagtcaggatccagaagtgcaagcagaaaaacatatgacaaggaacaatcagga
gatggctctaggcactcagggtcgcatcatcatgaagcttcctcttgggccgacagctct
agacactcactggtgggccagggacaatcatcagggcccaggacaagcaggccccgggga
tccagtgttagccaggacagtgacagtgagggacactcagaagattctgagaggcggtct
gggtctgcgtccagaaaccatcatggatctgctcaggagcagtcaagagatggctccaga
caccccaggtcccatcacgaagacagagccggtcatgggcactctgcagagagctccaga
caatcaggcactcatcatgcagagaattcctctggtggacaggctgcatcatcccatgaa
caggcaagatcaagtgcaggagagagacacggatcccaccaccagcagtcagcagacagc
tccagacactcaggcattgggcacggacaagcttcatctgcagtcagagacagtggacac
cgagggtccagtggtagtcaggccagtgacagtgagggacattcagaagactcagacaca
cagtcagtgtcagcccacggacaggctgggccccatcagcagagccaccaagagtccaca
cgtggccggtcagcaggaaggtctggacgttcagggtctttcctctaccaggtgagcact
catgaacagtctgagtccgcccatggacggaccgggaccagcactggaggaagacaagga
tcccaccacaagcaggcacgagacagctccaggcactcaacgtcccaagagggtcaggac
accattcatggacacccggggtcaagcagtggaggaaggcagggatcccactacgagcaa
ttggtagatagatctggacactcagggtctcatcacagccacaccacatcccagggaagg
tctgatgcctcccatgggcactcaggatccagaagtgcaagcagacaaactcgtaacgat
gaacaatcaggagacggctccaggcactcagggtcgcgtcaccatgaagcttcctctcgg
gccgacagctctggacactcgcaggtgggccagggacaatcagaggggcccaggacaagc
aggaactggggatccagttttagccaggacagtgacagtcagggacactcagaagactct
gagaggtggtctgggtctgcttccagaaaccatcatggatctgctcaggagcagctaaga
gatggctccagacaccccaggtcccatcaagaagacagagctggtcatgggcactctgca
gacagctccagacaatcaggcactcgtcacacacagacttcctctggtggacaggctgca
tcatcccatgaacaggcaagatcaagtgcaggagaaagacatggatcccaccaccagcag
tcagcagacagctccagacactcaggcattgggcacggacaagcttcatctgcagtcaga
gacagtggacaccgagggtacagtggtagtcaggccagtgacaatgagggacattcagaa
gactcagacacacagtcagtgtcagcccacggacaggctgggtcccatcagcagagccac
caagagtccgcacgtggccggtcaggggaaacgtctggacattcaggatctttcctctac
caggtgagcactcatgaacagtctgagtcctcccatggatggacggggcccagcactaga
ggaagacaaggatcccgccatgagcaggcacaagacagctccaggcactcagcatcccaa
gacggtcaggacaccattcgtggacacccggggtcaagcagaggaggaaggcaggggtac
caccacgagcattcggtagatagctctggacactcagggtcccatcacagccacaccaca
tcccagggaaggtctgatgcctcccgtgggcagtcaggatccagaagtgcaagcagaaca
acacgtaatgaggaacaatcaggagacggctccaggcactcagggtcgcgtcaccatgaa
gcttccactcatgccgacatctctagacactcacaggcagtccagggacaatcagagggg
tccaggagaagcaggcgccagggatccagtgtgagccaggacagtgacagtgagggacat
tcagaagactctgagaggtggtctgggtctgcttccagaaaccatcatggatctgctcag
gagcagctaagagatggctccagacaccccaggtcccatcaagaagacagagctggtcat
gggcactctgcagacagctccagacaatcaggcactcgtcacacacagacttcctctggt
ggacaggctgcatcatcccatgaacaggcaagatcaagtgcaggagaaagacatggatcc
caccaccagcagtcagcagacagctccagacactcaggcattgggcacggacaagcttca
tctgcagtcagagacagtggacaccgagggtacagtggtagtcaggccagtgacaatgag
ggacattcagaagactcagacacacagtcagtgtcagcccacggacaggctgggtcccat
cagcagagccaccaagagtccgcacgtggccggtcaggggaaacgtctggacattcagga
tctttcctctaccaggtgagcactcatgaacagtctgagtcctcccatggatggacgggg
cccagcactagaggaagacaaggatcccgccatgagcaggcacaagacagctccaggcac
tcagcatcccaatacggtcaggacaccattcgtggacacccggggtcaagcagaggagga
aggcaggggtaccaccacgagcattcggtagatagctctggacactcagggtcccatcac
agccacaccacatcccagggaaggtctgatgcctcccgtgggcagtcaggatccagaagt
gcaagcagaacaacacgtaatgaggaacaatcaggagacagctccaggcactcagtgtca
cgtcaccatgaagcttccactcatgccgacatctctagacactcacaggcagtccaggga
caatcagaggggtccaggagaagcaggcgccagggatccagtgtgagccaggacagtgac
agtgagggacattcagaagactctgagaggtggtctgggtctgcttccagaaaccatcgt
ggatctgttcaggagcagtcaaggcacggctccagacaccccaggtcccatcacgaagac
agagccggtcacgggcactctgcagaccgctccagacaatcaggcactcgtcacgcagag
acttcctctggtggacaggctgcatcatcccatgaacaggcaagatcaagtccaggagag
agacacggatcccgccaccagcagtcagcagacagctccagacactcaggcattccgcgt
ggacaagcttcatctgcagtcagagacagtagacactgggggtccagtggtagtcaggcc
agtgatagtgagggacattcagaagagtcagacacacagtcagtgtcaggccatggacag
gctgggccccatcagcagagccaccaagagtccgcacgtgaccggtcagggggaaggtct
ggacgttcagggtctttcctctaccaggtgagcactcatgaacagtctgagtctgcccat
gggcggaccaggaccagcactggacgaagacaaggatcccaccacgagcaggcacgagac
agctccaggcactcagcgtcccaagagggtcaggacaccattcgtggacacccggggtca
agcagaagaggaaggcagggatcccactacgagcaatcggtagataggtctggacactca
gggtcccatcacagccacaccacatcccagggaaggtctgatgcctcccgtgggcagtca
ggatccagaagtgccagcagacaaactcgtaatgacgaacaatcaggagatggctccagg
cactcatggtcgcatcaccatgaagcttccactcaggcggacagctctagacactcacag
tccggccagggacaatcagcggggcccaggacaagcaggaaccagggatccagtgttagc
caggacagtgacagtcagggacactcagaagactctgagaggtggtctgggtctgcttcc
agaaaccatcgtggatctgctcaggagcagtcaagagatggctccagacaccccacgtcc
catcacgaagacagagccggtcacgggcactctgcagagagctccagacaatcaggcact
catcatgcagagaattcctctggtggacaggctgcatcatcccatgaacaggcaagatca
agtgcaggagagagacatggatcccaccaccagcagtcagcagacagctccagacactca
ggcattgggcacggacaagcttcatctgcagtcagagacagtggacaccgagggtccagt
ggtagtcaggccagtgacagtgagggacattcagaagactcagacacacagtcagtgtca
gcccacggacaggctgggccccatcagcagagccaccaagagtccacacgtggccggtca
gcaggaaggtctggacgttcagggtctttcctctaccaggtgagcactcatgaacagtct
gagtctgcccatggacgggctgggcccagtactggaggaagacaaggatcccgccacgag
caggcacgagacagctccaggcactcagcgtcccaagagggtcaggacaccattcgtgga
cacccggggtcaaggagaggaggaagacagggatcctaccacgagcaatcggtagatagg
tctggacactcagggtcccatcacagccacaccacatcccagggaaggtctgatgcctcc
catgggcagtcaggatccagaagtgcaagcagagaaacacgtaatgaggaacagtcagga
gacggctccaggcactcagggtcgcgtcaccatgaagcttccactcaggctgacagctct
agacactcacagtccggccagggtgaatcagcggggtccaggagaagcaggcgccaggga
tccagtgttagccaggacagtgacagtgaggcatacccagaggactctgagaggcgatct
gagtctgcttccagaaaccatcatggatcttctcgggagcagtcaagagatggctccaga
caccccggatcctctcaccgcgatacagccagtcatgtacagtcttcacctgtacagtca
gactctagtaccgctaaggaacatggtcactttagtagtctttcacaagattctgcgtat
cactcaggaatacagtcacgtggcagtcctcacagttctagttcttatcattatcaatct
gagggcactgaaaggcaaaaaggtcaatcaggtttagtttggagacatggcagctatggt
agtgcagattatgattatggtgaatccgggtttagacactctcagcacggaagtgttagt
tacaattccaatcctgttgttttcaaggaaagatctgatatctgtaaagcaagtgcgttt
ggtaaagatcatccaaggtattatgcaacgtatattaataaggacccaggtttatgtggc
cattctagtgatatatcgaaacaactgggatttagtcagtcacagagatactattactat
gagtaa

DBGET integrated database retrieval system