KEGG   Homo sapiens (human): 2312Help
Entry
2312              CDS       T01001                                 

Gene name
FLG, ATOD2
Definition
(RefSeq) filaggrin
Organism
hsa  Homo sapiens (human)
Disease
H00735  
Ichthyosis vulgaris
H01358  
Atopic dermatitis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21.3
AA seq 4061 aa AA seqDB search
MSTLLENIFAIINLFKQYSKKDKNTDTLSKKELKELLEKEFRQILKNPDDPDMVDVFMDH
LDIDHNKKIDFTEFLLMVFKLAQAYYESTRKENLPISGHKHRKHSHHDKHEDNKQEENKE
NRKRPSSLERRNNRKGNKGRSKSPRETGGKRHESSSEKKERKGYSPTHREEEYGKNHHNS
SKKEKNKTENTRLGDNRKRLSERLEEKEDNEEGVYDYENTGRMTQKWIQSGHIATYYTIQ
DEAYDTTDSLLEENKIYERSRSSDGKSSSQVNRSRHENTSQVPLQESRTRKRRGSRVSQD
RDSEGHSEDSERHSGSASRNHHGSAWEQSRDGSRHPRSHDEDRASHGHSADSSRQSGTRH
AETSSRGQTASSHEQARSSPGERHGSGHQQSADSSRHSATGRGQASSAVSDRGHRGSSGS
QASDSEGHSENSDTQSVSGHGKAGLRQQSHQESTRGRSGERSGRSGSSLYQVSTHEQPDS
AHGRTGTSTGGRQGSHHEQARDSSRHSASQEGQDTIRGHPGSSRGGRQGSHHEQSVNRSG
HSGSHHSHTTSQGRSDASHGQSGSRSASRQTRNEEQSGDGTRHSGSRHHEASSQADSSRH
SQVGQGQSSGPRTSRNQGSSVSQDSDSQGHSEDSERWSGSASRNHHGSAQEQSRDGSRHP
RSHHEDRAGHGHSADSSRKSGTRHTQNSSSGQAASSHEQARSSAGERHGSRHQLQSADSS
RHSGTGHGQASSAVRDSGHRGSSGSQATDSEGHSEDSDTQSVSGHGQAGHHQQSHQESAR
DRSGERSRRSGSFLYQVSTHKQSESSHGWTGPSTGVRQGSHHEQARDNSRHSASQDGQDT
IRGHPGSSRRGRQGSHHEQSVDRSGHSGSHHSHTTSQGRSDASRGQSGSRSASRTTRNEE
QSRDGSRHSGSRHHEASSHADISRHSQAGQGQSEGSRTSRRQGSSVSQDSDSEGHSEDSE
RWSGSASRNHRGSAQEQSRHGSRHPRSHHEDRAGHGHSADSSRQSGTPHAETSSGGQAAS
SHEQARSSPGERHGSRHQQSADSSRHSGIPRRQASSAVRDSGHWGSSGSQASDSEGHSEE
SDTQSVSGHGQDGPHQQSHQESARDWSGGRSGRSGSFIYQVSTHEQSESAHGRTRTSTGR
RQGSHHEQARDSSRHSASQEGQDTIRAHPGSRRGGRQGSHHEQSVDRSGHSGSHHSHTTS
QGRSDASHGQSGSRSASRQTRKDKQSGDGSRHSGSRHHEAASWADSSRHSQVGQEQSSGS
RTSRHQGSSVSQDSDSERHSDDSERLSGSASRNHHGSSREQSRDGSRHPGFHQEDRASHG
HSADSSRQSGTHHTESSSHGQAVSSHEQARSSPGERHGSRHQQSADSSRHSGIGHRQASS
AVRDSGHRGSSGSQVTNSEGHSEDSDTQSVSAHGQAGPHQQSHKESARGQSGESSGRSRS
FLYQVSSHEQSESTHGQTAPSTGGRQGSRHEQARNSSRHSASQDGQDTIRGHPGSSRGGR
QGSYHEQSVDRSGHSGYHHSHTTPQGRSDASHGQSGPRSASRQTRNEEQSGDGSRHSGSR
HHEPSTRAGSSRHSQVGQGESAGSKTSRRQGSSVSQDRDSEGHSEDSERRSESASRNHYG
SAREQSRHGSRNPRSHQEDRASHGHSAESSRQSGTRHAETSSGGQAASSQEQARSSPGER
HGSRHQQSADSSTDSGTGRRQDSSVVGDSGNRGSSGSQASDSEGHSEESDTQSVSAHGQA
GPHQQSHQESTRGQSGERSGRSGSFLYQVSTHEQSESAHGRTGPSTGGRQRSRHEQARDS
SRHSASQEGQDTIRGHPGSSRGGRQGSHYEQSVDSSGHSGSHHSHTTSQERSDVSRGQSG
SRSVSRQTRNEKQSGDGSRHSGSRHHEASSRADSSRHSQVGQGQSSGPRTSRNQGSSVSQ
DSDSQGHSEDSERWSGSASRNHLGSAWEQSRDGSRHPGSHHEDRAGHGHSADSSRQSGTR
HTESSSRGQAASSHEQARSSAGERHGSHHQLQSADSSRHSGIGHGQASSAVRDSGHRGYS
GSQASDSEGHSEDSDTQSVSAQGKAGPHQQSHKESARGQSGESSGRSGSFLYQVSTHEQS
ESTHGQSAPSTGGRQGSHYDQAQDSSRHSASQEGQDTIRGHPGPSRGGRQGSHQEQSVDR
SGHSGSHHSHTTSQGRSDASRGQSGSRSASRKTYDKEQSGDGSRHSGSHHHEASSWADSS
RHSLVGQGQSSGPRTSRPRGSSVSQDSDSEGHSEDSERRSGSASRNHHGSAQEQSRDGSR
HPRSHHEDRAGHGHSAESSRQSGTHHAENSSGGQAASSHEQARSSAGERHGSHHQQSADS
SRHSGIGHGQASSAVRDSGHRGSSGSQASDSEGHSEDSDTQSVSAHGQAGPHQQSHQEST
RGRSAGRSGRSGSFLYQVSTHEQSESAHGRTGTSTGGRQGSHHKQARDSSRHSTSQEGQD
TIHGHPGSSSGGRQGSHYEQLVDRSGHSGSHHSHTTSQGRSDASHGHSGSRSASRQTRND
EQSGDGSRHSGSRHHEASSRADSSGHSQVGQGQSEGPRTSRNWGSSFSQDSDSQGHSEDS
ERWSGSASRNHHGSAQEQLRDGSRHPRSHQEDRAGHGHSADSSRQSGTRHTQTSSGGQAA
SSHEQARSSAGERHGSHHQQSADSSRHSGIGHGQASSAVRDSGHRGYSGSQASDNEGHSE
DSDTQSVSAHGQAGSHQQSHQESARGRSGETSGHSGSFLYQVSTHEQSESSHGWTGPSTR
GRQGSRHEQAQDSSRHSASQDGQDTIRGHPGSSRGGRQGYHHEHSVDSSGHSGSHHSHTT
SQGRSDASRGQSGSRSASRTTRNEEQSGDGSRHSGSRHHEASTHADISRHSQAVQGQSEG
SRRSRRQGSSVSQDSDSEGHSEDSERWSGSASRNHHGSAQEQLRDGSRHPRSHQEDRAGH
GHSADSSRQSGTRHTQTSSGGQAASSHEQARSSAGERHGSHHQQSADSSRHSGIGHGQAS
SAVRDSGHRGYSGSQASDNEGHSEDSDTQSVSAHGQAGSHQQSHQESARGRSGETSGHSG
SFLYQVSTHEQSESSHGWTGPSTRGRQGSRHEQAQDSSRHSASQYGQDTIRGHPGSSRGG
RQGYHHEHSVDSSGHSGSHHSHTTSQGRSDASRGQSGSRSASRTTRNEEQSGDSSRHSVS
RHHEASTHADISRHSQAVQGQSEGSRRSRRQGSSVSQDSDSEGHSEDSERWSGSASRNHR
GSVQEQSRHGSRHPRSHHEDRAGHGHSADRSRQSGTRHAETSSGGQAASSHEQARSSPGE
RHGSRHQQSADSSRHSGIPRGQASSAVRDSRHWGSSGSQASDSEGHSEESDTQSVSGHGQ
AGPHQQSHQESARDRSGGRSGRSGSFLYQVSTHEQSESAHGRTRTSTGRRQGSHHEQARD
SSRHSASQEGQDTIRGHPGSSRRGRQGSHYEQSVDRSGHSGSHHSHTTSQGRSDASRGQS
GSRSASRQTRNDEQSGDGSRHSWSHHHEASTQADSSRHSQSGQGQSAGPRTSRNQGSSVS
QDSDSQGHSEDSERWSGSASRNHRGSAQEQSRDGSRHPTSHHEDRAGHGHSAESSRQSGT
HHAENSSGGQAASSHEQARSSAGERHGSHHQQSADSSRHSGIGHGQASSAVRDSGHRGSS
GSQASDSEGHSEDSDTQSVSAHGQAGPHQQSHQESTRGRSAGRSGRSGSFLYQVSTHEQS
ESAHGRAGPSTGGRQGSRHEQARDSSRHSASQEGQDTIRGHPGSRRGGRQGSYHEQSVDR
SGHSGSHHSHTTSQGRSDASHGQSGSRSASRETRNEEQSGDGSRHSGSRHHEASTQADSS
RHSQSGQGESAGSRRSRRQGSSVSQDSDSEAYPEDSERRSESASRNHHGSSREQSRDGSR
HPGSSHRDTASHVQSSPVQSDSSTAKEHGHFSSLSQDSAYHSGIQSRGSPHSSSSYHYQS
EGTERQKGQSGLVWRHGSYGSADYDYGESGFRHSQHGSVSYNSNPVVFKERSDICKASAF
GKDHPRYYATYINKDPGLCGHSSDISKQLGFSQSQRYYYYE
NT seq 12186 nt NT seq  +upstreamnt  +downstreamnt
atgtctactctcctggaaaacatctttgccataattaatcttttcaagcaatattcaaaa
aaagataaaaacactgacacattgagtaaaaaagagctgaaggaacttctggaaaaggaa
tttcggcaaatcctgaagaatccagatgacccagatatggttgatgtcttcatggatcac
ttggatatagaccacaacaagaaaattgacttcactgagtttcttctgatggtattcaag
ttggctcaagcatattatgagtctaccagaaaagagaatttaccgatatcaggacacaag
cacagaaagcacagtcatcatgataaacatgaagataataaacaggaagaaaacaaagaa
aacagaaaaagaccctcaagtctggaaagaagaaacaatagaaaagggaataagggaaga
tccaagagcccaagagaaacaggggggaaaaggcatgaatctagttctgaaaaaaaagaa
agaaaaggatattcacctactcatagagaagaagaatatggaaaaaaccatcataactca
agtaaaaaagagaaaaacaagactgaaaatactagattaggagacaataggaagaggcta
agtgaaagacttgaagagaaagaagacaatgaagaaggagtatatgattatgaaaataca
ggaagaatgactcaaaaatggatacaatcaggccatattgccacatattacacaatccag
gatgaagcctatgacaccactgatagtctattagaagaaaacaaaatatatgaaagatca
aggtcatctgatggcaaatcatcatctcaagtgaacaggtcaagacatgaaaatacaagc
caggtaccattgcaggagtccaggacaagaaagcgtaggggatccagagttagccaggac
agggacagtgagggacactcagaagactctgagaggcactctgggtcggcttccagaaac
catcatggatctgcgtgggagcagtcaagagatggctccagacaccccaggtcccatgat
gaagacagagccagtcatgggcactctgcagacagctccagacaatcaggcactcgtcac
gcagagacttcctctcgtggacagactgcatcatcccatgaacaggcaagatcaagtcca
ggagaaagacatggatccggccaccagcagtcagcagacagctccagacactcagccact
gggcgcgggcaagcttcatctgcagtcagcgatcgtggacaccgggggtctagcggtagt
caggccagtgacagtgagggacattcagaaaactcagacacacaatcagtgtcaggccac
ggaaaggctgggctgagacagcagagccaccaagagtccacacgtggccggtcaggggaa
cggtctggacgttcagggtcttccctctaccaggtgagcactcatgaacagcctgactct
gcccatggacggaccgggaccagcactggaggaagacaaggatcgcaccacgagcaggca
cgagacagctccaggcattcagcgtcccaagagggtcaggacaccattcgtggacacccg
gggtcaagcagaggaggaaggcagggatcccaccacgagcaatcggtaaataggtctgga
cactcaggttcccatcacagccacaccacatcccagggaaggtctgatgcctcccatggg
cagtcaggatccagaagtgcaagcagacaaacacgaaatgaggaacaatcaggagacggc
accaggcactcagggtcacgtcatcatgaagcttcctctcaggctgacagctctagacac
tcacaggtgggccagggacaatcatcggggcccaggacaagtaggaaccagggatccagt
gttagccaggacagtgacagtcagggacactcagaagactctgagaggtggtctgggtct
gcttccagaaaccatcatggatctgctcaggagcagtcaagagatggctccagacacccc
aggtcccatcacgaagacagagctggtcatgggcactctgcagacagctccagaaaatca
ggcactcgtcacacacagaattcctctagtggacaggctgcgtcatcccatgaacaggca
agatcaagtgcaggagaaagacatggatcccgccaccagctccagtcagcagacagctcc
agacactcaggcactgggcacggacaagcttcatctgcagtcagagacagtggacaccga
gggtccagtggtagtcaggccactgacagtgagggacattcagaagactcagacacacag
tcagtgtcaggccatggacaggctggtcaccatcagcagagccaccaagagtccgcacgt
gaccggtcaggggaaaggtctcgacgttcagggtctttcctctaccaggtgagcactcat
aaacagtctgagtcctcccatggatggacagggcccagcactggagtaagacaaggatcc
caccatgagcaggcacgagacaactccaggcactcagcatcccaagatggtcaggacacc
attcgtggacacccggggtcaagcagaagaggaaggcaggggtcccaccacgagcaatcg
gtagataggtctggacactcagggtcccatcacagccacaccacatcccagggaaggtct
gatgcctcccgtgggcagtcaggatccagaagtgcaagcagaacaacacgtaatgaggaa
caatcaagagacggctccaggcactcagggtcacgtcaccatgaagcttcctctcatgcc
gacatctctagacactcacaggcaggccagggacaatcagaggggtccaggacaagcagg
cgccagggatccagtgttagccaggacagtgacagtgagggacattcagaagactctgag
aggtggtctgggtctgcttccagaaaccatcgtggatctgctcaggagcagtcaagacat
ggctccagacaccccaggtcccatcacgaagacagagccggtcacgggcactctgcagac
agctccagacaatcaggaactcctcacgcagagacttcctctggtggacaggctgcgtca
tcccatgaacaggcaagatcaagtccaggagaaagacacggatcccgccaccagcagtca
gcagacagctccagacactcaggcattccgcgcagacaagcttcatctgcagtcagagac
agtggacactgggggtccagtggtagtcaggccagtgatagtgagggacattcagaggag
tcagacacacagtcagtgtcaggccatggacaggatgggccccatcagcagagccaccaa
gagtccgcacgtgactggtcagggggaaggtctggacgttcagggtctttcatctaccag
gtgagcactcatgaacagtctgagtctgcccatgggcggaccaggaccagcactggacga
agacaaggatcccaccacgagcaggcacgagacagctccaggcactcagcgtcccaagag
ggtcaggacaccattcgtgcacacccggggtcaaggagaggaggaaggcagggatcccac
catgagcaatcggtagatagatctggacactcagggtcccatcacagccacaccacatcc
cagggaaggtctgatgcctcccatgggcagtcaggatccagaagtgcaagcagacaaact
cgtaaggacaaacaatcaggagacggctccaggcactcagggtcacgtcaccatgaagct
gcctcttgggctgacagctctagacactcacaggtgggacaggaacaatcatcggggtcc
aggacaagcaggcaccagggatccagtgttagccaggacagtgacagtgagagacactca
gacgactccgagaggttgtctgggtctgcttccagaaaccatcatggatcttctcgggag
cagtcaagagatggctccagacaccctgggttccatcaagaagacagagccagtcacggg
cactctgcagacagctccagacaatcaggcactcatcacacagagtcttcctctcatgga
caggctgtgtcatcccatgaacaggcaagatcaagtccaggagaaagacatggatcccgc
caccagcagtcagcagacagctccagacactcaggcattgggcacagacaagcttcatct
gcagtcagagacagtggacaccgagggtccagtggtagtcaggtcactaacagtgaggga
cattcagaagactcagacacacagtcagtgtcagcccacggacaagctgggccccatcag
cagagccacaaagagtccgcacgtggccagtcaggggaaagctctggacgttcaaggtct
ttcctctaccaggtgagctctcatgaacagtctgagtccacacacggacagactgcaccc
agcactggaggaagacaaggatcccgccatgagcaggcacgaaacagctctaggcactca
gcatcccaagacggtcaggacaccattcgtggacacccggggtcaagcagaggaggaagg
cagggatcctaccacgagcaatcagtagataggtctggacactcagggtaccatcacagc
cacaccacaccccagggaaggtctgatgcctcccatgggcagtcaggacccagaagtgca
agcaggcaaacaagaaatgaggaacaatcaggagacggctccaggcactcagggtcacgt
caccatgaaccttccactcgggccggcagctctagacactcacaggtgggccagggagaa
tcagcggggtccaagacaagcaggcgccagggatccagtgttagtcaggacagggacagt
gagggacactcagaagactctgagaggcggtctgagtcggcttccagaaaccattatgga
tctgctcgggagcagtcaagacatggctccaggaaccccaggtcccatcaagaagataga
gccagtcatgggcactctgcagagagctccagacaatcaggcactcgtcatgcagagact
tcctctggtggacaggctgcatcatcccaggaacaggcaaggtcaagtccaggagaaaga
catggatcccgccaccagcagtcagcagacagctccacagactcaggcactgggcgcaga
caagattcatctgtagtcggagacagtggaaaccgagggtccagtggtagccaggccagt
gacagcgagggacactcagaagagtcagacacacagtcagtgtcagcccacggacaggct
gggccccatcagcagagccaccaagagtccacacgtggccagtcaggggaaaggtctgga
cgttcagggtctttcctctaccaggtgagcactcatgaacagtctgagtccgcccatgga
cgcacagggcccagcactggaggaagacaaagatcccgccacgagcaggcacgagacagc
tccaggcactcagcgtcccaagagggtcaggacaccattcgtggacacccagggtcaagc
agaggaggaaggcagggatcccactatgagcaatcggtagatagttctggacactcaggg
tctcatcacagccacaccacgtcccaggaaaggtctgatgtctcccgtgggcagtcagga
tccagaagtgtcagcagacaaacacgtaatgagaaacaatcaggagacggctccaggcac
tcagggtcgcgtcaccatgaagcttcctctcgggccgacagctctagacactcgcaggtg
ggccagggacaatcatcagggcccaggacaagcaggaaccagggatccagtgttagccag
gacagtgacagtcagggacactcagaagactctgagaggtggtctgggtctgcttccaga
aaccatcttggatctgcttgggagcagtcaagagatggctccagacaccctgggtcccat
cacgaagacagagccggtcacgggcactctgcagacagctccagacaatcaggcactcgt
cacacagagtcttcctctcgtggacaggctgcgtcatcccatgaacaggcaagatcaagt
gcaggagaaagacatggatcccaccaccagctccagtcagcagacagctccagacactca
ggcattgggcatggacaagcttcatctgcagtcagagacagtggacaccgagggtacagt
ggtagtcaggccagtgacagtgagggacattcagaagactcagacacacagtcagtgtca
gcacagggaaaagctgggccccatcagcagagccacaaagagtccgcacgtggccagtca
ggggaaagctctggacgttcagggtctttcctctaccaggtgagcactcatgaacagtct
gagtccacccatggacagtctgcgcccagcactggaggaagacaaggatcccattatgat
caggcacaagacagctccaggcactcagcatcccaagagggtcaggacaccattcgtgga
cacccggggccaagcagaggaggaagacaggggtcccaccaagagcaatcggtagatagg
tctggacactcagggtctcatcacagccacaccacatcccagggaaggtctgatgcctcc
cgtgggcagtcaggatccagaagtgcaagcagaaaaacatatgacaaggaacaatcagga
gatggctctaggcactcagggtcgcatcatcatgaagcttcctcttgggccgacagctct
agacactcactggtgggccagggacaatcatcagggcccaggacaagcaggccccgggga
tccagtgttagccaggacagtgacagtgagggacactcagaagattctgagaggcggtct
gggtctgcgtccagaaaccatcatggatctgctcaggagcagtcaagagatggctccaga
caccccaggtcccatcacgaagacagagccggtcatgggcactctgcagagagctccaga
caatcaggcactcatcatgcagagaattcctctggtggacaggctgcatcatcccatgaa
caggcaagatcaagtgcaggagagagacacggatcccaccaccagcagtcagcagacagc
tccagacactcaggcattgggcacggacaagcttcatctgcagtcagagacagtggacac
cgagggtccagtggtagtcaggccagtgacagtgagggacattcagaagactcagacaca
cagtcagtgtcagcccacggacaggctgggccccatcagcagagccaccaagagtccaca
cgtggccggtcagcaggaaggtctggacgttcagggtctttcctctaccaggtgagcact
catgaacagtctgagtccgcccatggacggaccgggaccagcactggaggaagacaagga
tcccaccacaagcaggcacgagacagctccaggcactcaacgtcccaagagggtcaggac
accattcatggacacccggggtcaagcagtggaggaaggcagggatcccactacgagcaa
ttggtagatagatctggacactcagggtctcatcacagccacaccacatcccagggaagg
tctgatgcctcccatgggcactcaggatccagaagtgcaagcagacaaactcgtaacgat
gaacaatcaggagacggctccaggcactcagggtcgcgtcaccatgaagcttcctctcgg
gccgacagctctggacactcgcaggtgggccagggacaatcagaggggcccaggacaagc
aggaactggggatccagttttagccaggacagtgacagtcagggacactcagaagactct
gagaggtggtctgggtctgcttccagaaaccatcatggatctgctcaggagcagctaaga
gatggctccagacaccccaggtcccatcaagaagacagagctggtcatgggcactctgca
gacagctccagacaatcaggcactcgtcacacacagacttcctctggtggacaggctgca
tcatcccatgaacaggcaagatcaagtgcaggagaaagacatggatcccaccaccagcag
tcagcagacagctccagacactcaggcattgggcacggacaagcttcatctgcagtcaga
gacagtggacaccgagggtacagtggtagtcaggccagtgacaatgagggacattcagaa
gactcagacacacagtcagtgtcagcccacggacaggctgggtcccatcagcagagccac
caagagtccgcacgtggccggtcaggggaaacgtctggacattcaggatctttcctctac
caggtgagcactcatgaacagtctgagtcctcccatggatggacggggcccagcactaga
ggaagacaaggatcccgccatgagcaggcacaagacagctccaggcactcagcatcccaa
gacggtcaggacaccattcgtggacacccggggtcaagcagaggaggaaggcaggggtac
caccacgagcattcggtagatagctctggacactcagggtcccatcacagccacaccaca
tcccagggaaggtctgatgcctcccgtgggcagtcaggatccagaagtgcaagcagaaca
acacgtaatgaggaacaatcaggagacggctccaggcactcagggtcgcgtcaccatgaa
gcttccactcatgccgacatctctagacactcacaggcagtccagggacaatcagagggg
tccaggagaagcaggcgccagggatccagtgtgagccaggacagtgacagtgagggacat
tcagaagactctgagaggtggtctgggtctgcttccagaaaccatcatggatctgctcag
gagcagctaagagatggctccagacaccccaggtcccatcaagaagacagagctggtcat
gggcactctgcagacagctccagacaatcaggcactcgtcacacacagacttcctctggt
ggacaggctgcatcatcccatgaacaggcaagatcaagtgcaggagaaagacatggatcc
caccaccagcagtcagcagacagctccagacactcaggcattgggcacggacaagcttca
tctgcagtcagagacagtggacaccgagggtacagtggtagtcaggccagtgacaatgag
ggacattcagaagactcagacacacagtcagtgtcagcccacggacaggctgggtcccat
cagcagagccaccaagagtccgcacgtggccggtcaggggaaacgtctggacattcagga
tctttcctctaccaggtgagcactcatgaacagtctgagtcctcccatggatggacgggg
cccagcactagaggaagacaaggatcccgccatgagcaggcacaagacagctccaggcac
tcagcatcccaatacggtcaggacaccattcgtggacacccggggtcaagcagaggagga
aggcaggggtaccaccacgagcattcggtagatagctctggacactcagggtcccatcac
agccacaccacatcccagggaaggtctgatgcctcccgtgggcagtcaggatccagaagt
gcaagcagaacaacacgtaatgaggaacaatcaggagacagctccaggcactcagtgtca
cgtcaccatgaagcttccactcatgccgacatctctagacactcacaggcagtccaggga
caatcagaggggtccaggagaagcaggcgccagggatccagtgtgagccaggacagtgac
agtgagggacattcagaagactctgagaggtggtctgggtctgcttccagaaaccatcgt
ggatctgttcaggagcagtcaaggcacggctccagacaccccaggtcccatcacgaagac
agagccggtcacgggcactctgcagaccgctccagacaatcaggcactcgtcacgcagag
acttcctctggtggacaggctgcatcatcccatgaacaggcaagatcaagtccaggagag
agacacggatcccgccaccagcagtcagcagacagctccagacactcaggcattccgcgt
ggacaagcttcatctgcagtcagagacagtagacactgggggtccagtggtagtcaggcc
agtgatagtgagggacattcagaagagtcagacacacagtcagtgtcaggccatggacag
gctgggccccatcagcagagccaccaagagtccgcacgtgaccggtcagggggaaggtct
ggacgttcagggtctttcctctaccaggtgagcactcatgaacagtctgagtctgcccat
gggcggaccaggaccagcactggacgaagacaaggatcccaccacgagcaggcacgagac
agctccaggcactcagcgtcccaagagggtcaggacaccattcgtggacacccggggtca
agcagaagaggaaggcagggatcccactacgagcaatcggtagataggtctggacactca
gggtcccatcacagccacaccacatcccagggaaggtctgatgcctcccgtgggcagtca
ggatccagaagtgccagcagacaaactcgtaatgacgaacaatcaggagatggctccagg
cactcatggtcgcatcaccatgaagcttccactcaggcggacagctctagacactcacag
tccggccagggacaatcagcggggcccaggacaagcaggaaccagggatccagtgttagc
caggacagtgacagtcagggacactcagaagactctgagaggtggtctgggtctgcttcc
agaaaccatcgtggatctgctcaggagcagtcaagagatggctccagacaccccacgtcc
catcacgaagacagagccggtcacgggcactctgcagagagctccagacaatcaggcact
catcatgcagagaattcctctggtggacaggctgcatcatcccatgaacaggcaagatca
agtgcaggagagagacatggatcccaccaccagcagtcagcagacagctccagacactca
ggcattgggcacggacaagcttcatctgcagtcagagacagtggacaccgagggtccagt
ggtagtcaggccagtgacagtgagggacattcagaagactcagacacacagtcagtgtca
gcccacggacaggctgggccccatcagcagagccaccaagagtccacacgtggccggtca
gcaggaaggtctggacgttcagggtctttcctctaccaggtgagcactcatgaacagtct
gagtctgcccatggacgggctgggcccagtactggaggaagacaaggatcccgccacgag
caggcacgagacagctccaggcactcagcgtcccaagagggtcaggacaccattcgtgga
cacccggggtcaaggagaggaggaagacagggatcctaccacgagcaatcggtagatagg
tctggacactcagggtcccatcacagccacaccacatcccagggaaggtctgatgcctcc
catgggcagtcaggatccagaagtgcaagcagagaaacacgtaatgaggaacagtcagga
gacggctccaggcactcagggtcgcgtcaccatgaagcttccactcaggctgacagctct
agacactcacagtccggccagggtgaatcagcggggtccaggagaagcaggcgccaggga
tccagtgttagccaggacagtgacagtgaggcatacccagaggactctgagaggcgatct
gagtctgcttccagaaaccatcatggatcttctcgggagcagtcaagagatggctccaga
caccccggatcctctcaccgcgatacagccagtcatgtacagtcttcacctgtacagtca
gactctagtaccgctaaggaacatggtcactttagtagtctttcacaagattctgcgtat
cactcaggaatacagtcacgtggcagtcctcacagttctagttcttatcattatcaatct
gagggcactgaaaggcaaaaaggtcaatcaggtttagtttggagacatggcagctatggt
agtgcagattatgattatggtgaatccgggtttagacactctcagcacggaagtgttagt
tacaattccaatcctgttgttttcaaggaaagatctgatatctgtaaagcaagtgcgttt
ggtaaagatcatccaaggtattatgcaacgtatattaataaggacccaggtttatgtggc
cattctagtgatatatcgaaacaactgggatttagtcagtcacagagatactattactat
gagtaa

DBGET integrated database retrieval system