KEGG   Homo sapiens (human): 23127Help
Entry
23127             CDS       T01001                                 

Gene name
COLGALT2, C1orf17, GLT25D2
Definition
(RefSeq) collagen beta(1-O)galactosyltransferase 2
  KO
K11703  
collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    23127 (COLGALT2)
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    23127 (COLGALT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     23127 (COLGALT2)
Glycosyltransferases [BR:hsa01003]
 O-Glycan biosynthesis
  O-linked Gal type
   23127 (COLGALT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8IYK4(Tbio)
UniProt: 
Position
1q25.3
AA seq 626 aa AA seqDB search
MAARPAATLAWSLLLLSSALLREGCRARFVAERDSEDDGEEPVVFPESPLQSPTVLVAVL
ARNAAHTLPHFLGCLERLDYPKSRMAIWAATDHNVDNTTEIFREWLKNVQRLYHYVEWRP
MDEPESYPDEIGPKHWPTSRFAHVMKLRQAALRTAREKWSDYILFIDVDNFLTNPQTLNL
LIAENKTIVAPMLESRGLYSNFWCGITPKGFYKRTPDYVQIREWKRTGCFPVPMVHSTFL
IDLRKEASDKLTFYPPHQDYTWTFDDIIVFAFSSRQAGIQMYLCNREHYGYLPIPLKPHQ
TLQEDIENLIHVQIEAMIDRPPMEPSQYVSVVPKYPDKMGFDEIFMINLKRRKDRRDRML
RTLYEQEIEVKIVEAVDGKALNTSQLKALNIEMLPGYRDPYSSRPLTRGEIGCFLSHYSV
WKEVIDRELEKTLVIEDDVRFEHQFKKKLMKLMDNIDQAQLDWELIYIGRKRMQVKEPEK
AVPNVANLVEADYSYWTLGYVISLEGAQKLVGANPFGKMLPVDEFLPVMYNKHPVAEYKE
YYESRDLKAFSAEPLLIYPTHYTGQPGYLSDTETSTIWDNETVATDWDRTHAWKSRKQSR
IYSNAKNTEALPPPTSLDTVPSRDEL
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgcgccctgctgccaccctcgcctggtcgctactgctcctctcctcagccctg
ctccgcgaaggctgccgagcgcgcttcgtcgccgagcgggactcggaggacgacggagag
gagccggtggttttcccggagtcgcccctgcagagccccacggtgctcgtggcggtcctc
gcccgcaacgcggcgcacacgctgccgcacttcctcggctgcctggagcggctggactac
cccaagagcaggatggccatctgggcagccactgatcacaatgtggataatacaacagaa
atattcagggagtggttgaaaaatgtacagagactctatcactatgtggagtggaggcct
atggatgaaccagagtcttaccctgatgaaattggaccaaagcactggccaacctcccgg
tttgcccatgtgatgaaactacgacaggcagcccttcgaactgcgagggaaaaatggtca
gactacattctgttcatagatgttgacaatttcctgactaatccacagaccctcaatcta
ctgattgcagaaaacaaaactattgtggcccccatgctggagtctcggggcctgtattct
aatttctggtgcggaatcacccctaagggcttctataagaggaccccagactacgttcag
attcgagaatggaagaggacaggctgcttccccgtccccatggtccactccaccttccta
attgacctcaggaaggaggcctcggacaagctgactttctaccccccacaccaggactac
acctggacctttgatgacatcattgtctttgccttctccagcaggcaagcaggcatccag
atgtacctctgcaacagagagcactatggctacctgcccatccccctgaagccccatcag
acactgcaggaagacatcgagaacctcatccatgtgcagattgaagcaatgattgaccgt
cctccaatggaaccctcccagtatgtctcagttgtccctaaatatccagacaagatggga
tttgatgagattttcatgataaacctcaaacgcagaaaggacaggcgggaccggatgctg
cgcacactgtatgaacaggagattgaggtcaagattgtcgaggctgtggatggaaaggca
ctcaacacaagccagctgaaggcactgaatattgaaatgctgcctggctatcgagatccc
tattcctccaggcctctaacaaggggtgaaatcggctgctttctcagccactactcagtc
tggaaagaggtaattgatcgagagctagagaagactcttgtaattgaagacgatgtgcgt
tttgagcatcagtttaagaagaagctgatgaagctgatggataacattgaccaggctcag
ctggactgggaactgatttatattggtaggaagaggatgcaagtaaaggagccagagaaa
gcagtgcccaatgtggcaaacctggtcgaagccgactattcctactggaccctgggctac
gtcatctctctggaaggagcacagaagctggttggagccaatccttttgggaagatgctg
ccagtggatgagtttctgccagtcatgtacaacaagcatcccgtagccgagtacaaggag
tattatgaatccagggacctgaaagccttctctgcagaacccttgctcatctaccctacg
cactacacaggccagccggggtacctgagtgacacggagacctccaccatctgggacaat
gagacagtggccaccgactgggataggacacatgcctggaagtcccggaagcaaagccgc
atctacagcaatgccaagaacacagaggccctgccaccgccaacctccctggacactgtg
ccttcaagggatgagctatga

DBGET integrated database retrieval system