KEGG   Homo sapiens (human): 23133Help
Entry
23133             CDS       T01001                                 

Gene name
PHF8, JHDM1F, MRXSSD, ZNF422
Definition
(RefSeq) PHD finger protein 8 (EC:1.14.11.27)
  KO
K19415  
lysine-specific demethylase PHF8 [EC:1.14.11.27]
Organism
hsa  Homo sapiens (human)
Disease
H00658  
Syndromic X-linked mental retardation
Brite
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.27  [histone-H3]-lysine-36 demethylase
     23133 (PHF8)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    23133 (PHF8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.22
AA seq 1060 aa AA seqDB search
MNRSRAIVQRGRVLPPPAPLDTTNLAGRRTLQGRAKMASVPVYCLCRLPYDVTRFMIECD
MCQDWFHGSCVGVEEEKAADIDLYHCPNCEVLHGPSIMKKRRGSSKGHDTHKGKPVKTGS
PTFVRELRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTV
RDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLV
ETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEK
IFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTP
VDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHILDIFRGLRE
NRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVEDIF
QQNVGKTSNIFGLQRIFPAGSIPLTRPAHSTSVSMSRLSLPSKNGSKKKGLKPKELFKKA
ERKGKESSALGPAGQLSYNLMDTYSHQALKTGSFQKAKFNITGACLNDSDDDSPDLDLDG
NESPLALLMSNGSTKRVKSLSKSRRTKIAKKVDKARLMAEQVMEDEFDLDSDDELQIDER
LGKEKATLIIRPKFPRKLPRAKPCSDPNRVREPGEVEFDIEEDYTTDEDMVEGVEGKLGN
GSGAGGILDLLKASRQVGGPDYAALTEAPASPSTQEAIQGMLCMANLQSSSSSPATSSLQ
AWWTGGQDRSSGSSSSGLGTVSNSPASQRTPGKRPIKRPAYWRTESEEEEENASLDEQDS
LGACFKDAEYIYPSLESDDDDPALKSRPKKKKNSDDAPWSPKARVTPTLPKQDRPVREGT
RVASIETGLAAAAAKLAQQELQKAQKKKYIKKKPLLKEVEQPRPQDSNLSLTVPAPTVAA
TPQLVTSSSPLPPPEPKQEALSGSLADHEYTARPNAFGMAQANRSTTPMAPGVFLTQRRP
SVGSQSNQAGQGKRPKKGLATAKQRLGRILKIHRNGKLLL
NT seq 3183 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggagccgcgctatcgtccagagaggacgcgtgctgccgcctcccgcccctctt
gacacgacgaacctggccggccgcagaacgctccagggccgagcgaagatggcctcggtg
ccggtgtattgcctctgccggctgccttacgatgtgacccgcttcatgatcgagtgtgac
atgtgccaggactggtttcatggcagttgtgttggtgttgaagaggagaaggctgctgac
attgacctctaccactgccccaactgtgaagtcttgcatgggccctccattatgaaaaaa
cgccgtggatcttcaaaggggcatgatacacacaaggggaaaccagtgaagaccgggagc
cctacgttcgtcagagagctccggagtaggacttttgacagctcagatgaagtgattctg
aagcccactggaaatcaactgaccgtggaattcctggaagaaaatagcttcagtgtgccc
atcctggtcctgaagaaggatgggttgggcatgacgctgccctcgccatcattcactgtg
agggatgttgaacactatgttggttctgacaaagagattgatgtgattgatgtgacccgc
caggctgactgcaagatgaagcttggtgattttgtgaaatactattacagcgggaagagg
gagaaagtcctcaatgtcattagtttggaattctctgataccagactttctaaccttgtg
gagacaccgaagattgttcgaaagctgtcatgggtcgaaaacttgtggccagaggaatgt
gtctttgagagacccaatgtacagaagtactgcctcatgagtgtgcgagatagctataca
gactttcacattgactttggtggcacctctgtctggtaccatgtactcaagggtgaaaag
atcttctacctgatccgcccaacaaatgccaatctgactctctttgagtgctggagcagt
tcctctaatcagaatgagatgttctttggggaccaggtggacaagtgctacaagtgttcc
gtgaagcaaggacagacacttttcattcccacagggtggatccatgctgtgctgacgcct
gtggactgccttgcctttggagggaacttcttacacagccttaacatcgagatgcagctc
aaagcctatgagattgagaagcggctgagcacagcagacctcttcagattccccaacttt
gagaccatctgttggtatgtgggaaagcacatcctggacatctttcgcggtttgcgagag
aacaggagacaccctgcctcctacctggtccatggtggcaaagccttgaacttggccttt
agagcctggacaaggaaagaagctctgccagaccatgaggatgagatcccggagacagtg
cgaaccgtacagctcattaaagatctggccagggagatccgcctggtggaagacatcttc
caacagaacgttgggaagacgagcaatatctttgggctgcagaggatcttcccagccggc
tccattcccctaaccaggccagcccattccacttcagtgtccatgtccaggctgtcactg
ccctccaaaaatggttcaaagaagaaaggcctgaagcccaaggaactcttcaagaaggca
gagcgaaagggcaaggagagttcagccttggggcctgctggccagttgagctataatctc
atggacacatacagtcatcaggcactgaagacaggctctttccagaaagcaaagttcaac
atcactggtgcctgcttgaatgactcagatgacgactcaccagacttggaccttgatgga
aatgagagcccattggccctattgatgtctaacggcagtacgaaaagggtgaagagttta
tccaaatctcggcgaaccaagatagcaaagaaggtagacaaggctaggctgatggcagaa
caggtgatggaagacgaatttgacttggattcagatgatgagctgcagattgacgagaga
ttgggaaaggagaaggcgaccctgataataagaccaaaatttccccggaaattgccccgt
gcgaagccttgctctgaccccaaccgagttcgtgaaccaggagaagttgagtttgacatt
gaggaggactatacaacagatgaggacatggtggaaggggttgaaggcaagcttgggaat
ggtagtggcgctggtggcattcttgatctgctcaaggccagcaggcaggtggggggacct
gactatgctgccctcaccgaggccccagcttctcccagcactcaggaggccatccagggc
atgctgtgcatggccaacctgcagtcctcatcgtcctcaccggctacctctagcctgcag
gcctggtggactgggggacaggatcgaagcagtgggagctccagcagtgggctgggcaca
gtgtctaacagtcctgcttcccagcgcaccccagggaagcggcccatcaagcggccagca
tactggagaaccgagagcgaggaggaggaggagaacgccagtctggatgaacaggacagc
ttgggagcgtgcttcaaggatgcagagtatatctatccttcactggagtctgatgatgat
gaccctgctttgaaatctcgacccaagaaaaagaagaattcagatgatgctccatggagt
cctaaagcccgcgtgaccccaactctgccgaagcaggaccgtcctgtgcgtgaggggacc
cgggtagcctctattgagacaggtttggctgcagcagctgcaaagctggcccagcaggag
ctacagaaggcccaaaagaagaaatatatcaagaagaagcctttgctgaaggaggtagaa
cagcctcgccctcaagactccaatctcagtctgacagtaccagcccccactgtggctgcc
acaccacaacttgtcacctcctcctcacccctgcctcctcctgagcctaaacaagaggcc
ctgtcaggaagtctcgctgaccatgagtacaccgctcgtcccaatgcctttggcatggcc
caggcaaaccgcagcaccacacctatggcccccggtgtcttcttgacccagcggcgccct
tcagttggctcccagagcaatcaggcaggacaaggaaagcgtcccaaaaagggcctggcc
acagcaaagcagagactcggccgtatcctgaaaatccacagaaatggcaaactacttctg
tga

DBGET integrated database retrieval system