KEGG   Homo sapiens (human): 23135Help
Entry
23135             CDS       T01001                                 

Gene name
KDM6B, JMJD3
Definition
(RefSeq) lysine demethylase 6B
  KO
K11448  
lysine-specific demethylase 6B [EC:1.14.11.-]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     23135 (KDM6B)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    23135 (KDM6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p13.1
AA seq 1682 aa AA seqDB search
MHRAVDPPGARAAREAFALGGLSCAGAWSSCPPHPPPRSAWLPGGRCSASIGQPPLPAPL
PPSHGSSSGHPSKPYYAPGAPTPRPLHGKLESLHGCVQALLREPAQPGLWEQLGQLYESE
HDSEEATRCYHSALRYGGSFAELGPRIGRLQQAQLWNFHTGSCQHRAKVLPPLEQVWNLL
HLEHKRNYGAKRGGPPVKRAAEPPVVQPVPPAALSGPSGEEGLSPGGKRRRGCNSEQTGL
PPGLPLPPPPLPPPPPPPPPPPPPLPGLATSPPFQLTKPGLWSTLHGDAWGPERKGSAPP
ERQEQRHSLPHPYPYPAPAYTAHPPGHRLVPAAPPGPGPRPPGAESHGCLPATRPPGSDL
RESRVQRSRMDSSVSPAATTACVPYAPSRPPGLPGTTTSSSSSSSSNTGLRGVEPNPGIP
GADHYQTPALEVSHHGRLGPSAHSSRKPFLGAPAATPHLSLPPGPSSPPPPPCPRLLRPP
PPPAWLKGPACRAAREDGEILEELFFGTEGPPRPAPPPLPHREGFLGPPASRFSVGTQDS
HTPPTPPTPTTSSSNSNSGSHSSSPAGPVSFPPPPYLARSIDPLPRPPSPAQNPQDPPLV
PLTLALPPAPPSSCHQNTSGSFRRPESPRPRVSFPKTPEVGPGPPPGPLSKAPQPVPPGV
GELPARGPRLFDFPPTPLEDQFEEPAEFKILPDGLANIMKMLDESIRKEEEQQQHEAGVA
PQPPLKEPFASLQSPFPTDTAPTTTAPAVAVTTTTTTTTTTTATQEEEKKPPPALPPPPP
LAKFPPPSQPQPPPPPPPSPASLLKSLASVLEGQKYCYRGTGAAVSTRPGPLPTTQYSPG
PPSGATALPPTSAAPSAQGSPQPSASSSSQFSTSGGPWARERRAGEEPVPGPMTPTQPPP
PLSLPPARSESEVLEEISRACETLVERVGRSATDPADPVDTAEPADSGTERLLPPAQAKE
EAGGVAAVSGSCKRRQKEHQKEHRRHRRACKDSVGRRPREGRAKAKAKVPKEKSRRVLGN
LDLQSEEIQGREKSRPDLGGASKAKPPTAPAPPSAPAPSAQPTPPSASVPGKKAREEAPG
PPGVSRADMLKLRSLSEGPPKELKIRLIKVESGDKETFIASEVEERRLRMADLTISHCAA
DVVRASRNAKVKGKFRESYLSPAQSVKPKINTEEKLPREKLNPPTPSIYLESKRDAFSPV
LLQFCTDPRNPITVIRGLAGSLRLNLGLFSTKTLVEASGEHTVEVRTQVQQPSDENWDLT
GTRQIWPCESSRSHTTIAKYAQYQASSFQESLQEEKESEDEESEEPDSTTGTPPSSAPDP
KNHHIIKFGTNIDLSDAKRWKPQLQELLKLPAFMRVTSTGNMLSHVGHTILGMNTVQLYM
KVPGSRTPGHQENNNFCSVNINIGPGDCEWFAVHEHYWETISAFCDRHGVDYLTGSWWPI
LDDLYASNIPVYRFVQRPGDLVWINAGTVHWVQATGWCNNIAWNVGPLTAYQYQLALERY
EWNEVKNVKSIVPMIHVSWNVARTVKISDPDLFKMIKFCLLQSMKHCQVQRESLVRAGKK
IAYQGRVKDEPAYYCNECDVEVFNILFVTSENGSRNTYLVHCEGCARRRSAGLQGVVVLE
QYRTEELAQAYDAFTLVRARRARGQRRRALGQAAGTGFGSPAAPFPEPPPAFSPQAPAST
SR
NT seq 5049 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgggcagtggaccctccaggggcccgcgctgcacgggaagcctttgcccttggg
ggcctgagctgtgctggggcctggagctcctgcccgcctcatccccctcctcgtagcgca
tggctgcctggaggcagatgctcagccagcattgggcagcccccgcttcctgctccccta
cccccttcacatggcagtagttctgggcaccccagcaaaccatattatgctccaggggcg
cccactccaagacccctccatgggaagctggaatccctgcatggctgtgtgcaggcattg
ctccgggagccagcccagccagggctttgggaacagcttgggcaactgtacgagtcagag
cacgatagtgaggaggccacacgctgctaccacagcgcccttcgatacggaggaagcttc
gctgagctggggccccgcattggccgactgcagcaggcccagctctggaactttcatact
ggctcctgccagcaccgagccaaggtcctgcccccactggagcaagtgtggaacttgcta
caccttgagcacaaacggaactatggagccaagcggggaggtcccccggtgaagcgagct
gctgaacccccagtggtgcagcctgtgcctcctgcagcactctcaggcccctcaggggag
gagggcctcagccctggaggcaagcgaaggagaggctgcaactctgaacagactggcctt
cccccagggctgccactgcctccaccaccattaccaccaccaccaccaccaccaccacca
ccaccaccacccctgcctggcctggctaccagccccccatttcagctaaccaagccaggg
ctgtggagtaccctgcatggagatgcctggggcccagagcgcaagggttcagcaccccca
gagcgccaggagcagcggcactcgctgcctcacccatatccatacccagctccagcgtac
accgcgcacccccctggccaccggctggtcccggctgctcccccaggcccaggcccccgc
cccccaggagcagagagccatggctgcctgcctgccacccgtccccccggaagtgacctt
agagagagcagagttcagaggtcgcggatggactccagcgtttcaccagcagcaaccacc
gcctgcgtgccttacgccccttcccggccccctggcctccccggcaccaccaccagcagc
agcagtagcagcagcagcaacactggtctccggggcgtggagccgaacccaggcattccc
ggcgctgaccattaccaaactcccgcgctggaggtctctcaccatggccgcctggggccc
tcggcacacagcagtcggaaaccgttcttgggggctcccgctgccactccccacctatcc
ctgccacctggaccttcctcaccccctccacccccctgtccccgcctcttacgcccccca
ccaccccctgcctggttgaagggtccggcctgccgggcagcccgagaggatggagagatc
ttagaagagctcttctttgggactgagggacccccccgccctgccccaccacccctcccc
catcgcgagggcttcttggggcctccggcctcccgcttttctgtgggcactcaggattct
cacacccctcccactcccccaaccccaaccaccagcagtagcaacagcaacagtggcagc
cacagcagcagccctgctgggcctgtgtcctttcccccaccaccctatctggccagaagt
atagacccccttccccggcctcccagcccagcacagaacccccaggacccacctcttgta
cccctgactcttgccctgcctccagcccctccttcctcctgccaccaaaatacctcagga
agcttcaggcgcccggagagcccccggcccagggtctccttcccaaagacccccgaggtg
gggccggggccacccccaggccccctgagtaaagccccccagcctgtgccgcccggggtt
ggggagctgcctgcccgaggccctcgactctttgattttccccccactccgctggaggac
cagtttgaggagccagccgaattcaagatcctacctgatgggctggccaacatcatgaag
atgctggacgaatccattcgcaaggaagaggaacagcaacaacacgaagcaggcgtggcc
ccccaacccccgctgaaggagccctttgcatctctgcagtctcctttccccaccgacaca
gcccccaccactactgctcctgctgtcgccgtcaccaccaccaccaccaccaccaccacc
accacggccacccaggaagaggagaagaagccaccaccagccctaccaccaccaccgcct
ctagccaagttccctccaccctctcagccacagccaccaccacccccaccccccagcccg
gccagcctgctcaaatccttggcctccgtgctggagggacaaaagtactgttatcggggg
actggagcagctgtttccacccggcctgggcccttgcccaccactcagtattcccctggc
cccccatcaggtgctaccgccctgccgcccacctcagcggcccctagcgcccagggctcc
ccacagccctctgcttcctcgtcatctcagttctctacctcaggcgggccctgggcccgg
gagcgcagggcgggcgaagagccagtcccgggccccatgacccccacccaaccgccccca
cccctatctctgccccctgctcgctctgagtctgaggtgctagaagagatcagccgggct
tgcgagacccttgtggagcgggtgggccggagtgccactgacccagccgacccagtggac
acagcagagccagcggacagtgggactgagcgactgctgccccccgcacaggccaaggag
gaggctggcggggtggcggcagtgtcaggcagctgtaagcggcgacagaaggagcatcag
aaggagcatcggcggcacaggcgggcctgtaaggacagtgtgggtcgtcggccccgtgag
ggcagggcaaaggccaaggccaaggtccccaaagaaaagagccgccgggtgctggggaac
ctggacctgcagagcgaggagatccagggtcgtgagaagtcccggcccgatcttggcggg
gcctccaaggccaagccacccacagctccagcccctccatcagctcctgcaccttctgcc
cagcccacacccccgtcagcctctgtccctggaaagaaggctcgggaggaagccccaggg
ccaccgggtgtcagccgggccgacatgctgaagctgcgctcacttagtgaggggcccccc
aaggagctgaagatccggctcatcaaggtagagagtggtgacaaggagacctttatcgcc
tctgaggtggaagagcggcggctgcgcatggcagacctcaccatcagccactgtgctgct
gacgtcgtgcgcgccagcaggaatgccaaggtgaaagggaagtttcgagagtcctacctt
tcccctgcccagtctgtgaaaccgaagatcaacactgaggagaagctgccccgggaaaaa
ctcaacccccctacacccagcatctatctggagagcaaacgggatgccttctcacctgtc
ctgctgcagttctgtacagaccctcgaaatcccatcacagtgatccggggcctggcgggc
tccctgcggctcaacttgggcctcttctccaccaagaccctggtggaagcgagtggcgaa
cacaccgtggaagttcgcacccaggtgcagcagccctcagatgagaactgggatctgaca
ggcactcggcagatctggccttgtgagagctcccgttcccacaccaccattgccaagtac
gcacagtaccaggcctcatccttccaggagtctctgcaggaggagaaggagagtgaggat
gaggagtcagaggagccagacagcaccactggaacccctcctagcagcgcaccagacccg
aagaaccatcacatcatcaagtttggcaccaacatcgacttgtctgatgctaagcggtgg
aagccccagctgcaggagctgctgaagctgcccgccttcatgcgggtaacatccacgggc
aacatgctgagccacgtgggccacaccatcctgggcatgaacacggtgcagctgtacatg
aaggtgcccggcagccgaacgccaggccaccaggagaataacaacttctgctccgtcaac
atcaacattggcccaggcgactgcgagtggttcgcggtgcacgagcactactgggagacc
atcagcgctttctgtgatcggcacggcgtggactacttgacgggttcctggtggccaatc
ctggatgatctctatgcatccaatattcctgtgtaccgcttcgtgcagcgacccggagac
ctcgtgtggattaatgcggggactgtgcactgggtgcaggccaccggctggtgcaacaac
attgcctggaacgtggggcccctcaccgcctatcagtaccagctggccctggaacgatac
gagtggaatgaggtgaagaacgtcaaatccatcgtgcccatgattcacgtgtcatggaac
gtggctcgcacggtcaaaatcagcgaccccgacttgttcaagatgatcaagttctgcctg
ctgcagtccatgaagcactgccaggtgcaacgcgagagcctggtgcgggcagggaagaaa
atcgcttaccagggccgtgtcaaggacgagccagcctactactgcaacgagtgcgatgtg
gaggtgtttaacatcctgttcgtgacaagtgagaatggcagccgcaacacgtacctggta
cactgcgagggctgtgcccggcgccgcagcgcaggcctgcagggcgtggtggtgctggag
cagtaccgcactgaggagctggctcaggcctacgacgccttcacgctggtgagggcccgg
cgggcgcgcgggcagcggaggagggcactggggcaggctgcagggacgggcttcgggagc
ccggccgcgcctttccctgagcccccgccggctttctccccccaggccccagccagcacg
tcgcgatga

DBGET integrated database retrieval system