KEGG   Homo sapiens (human): 23136Help
Entry
23136             CDS       T01001                                 

Gene name
EPB41L3, 4.1B, DAL-1, DAL1
Definition
(RefSeq) erythrocyte membrane protein band 4.1 like 3
  KO
K06107  erythrocyte membrane protein band 4.1
Organism
hsa  Homo sapiens (human)
Brite
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     23136 (EPB41L3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 4_1_CTD SAB FERM_C FERM_N FERM_M FA RNA_pol_Rpc4
Motif
Other DBs
NCBI-GeneID: 23136
NCBI-ProteinID: NP_036439
OMIM: 605331
HGNC: 3380
Ensembl: ENSG00000082397
Vega: OTTHUMG00000131562
Pharos: Q9Y2J2(Tbio)
UniProt: Q9Y2J2
Structure
PDB: 

Jmol
Position
18p11.31
AA seq 1087 aa AA seqDB search
MTTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPKEEQQQALEQFAAAAAHSTPVRR
EVTDKEQEFAARAAKQLEYQQLEDDKLSQKSSSSKLSRSPLKIVKKPKSMQCKVILLDGS
EYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAW
HFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDY
DPDECGSDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDL
HHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFE
STIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRRAS
ALIDRPAPYFERSSSKRYTMSRSLDGEVGTGQYATTKGISQTNLITTVTPEKKAEEERDE
EEDKRRKGEEVTPISAIRHEGKSPGLGTDSCPLSPPSTHCAPTSPTELRRRCKENDCKLP
GYEPSRAEHLPGEPALDSDGPGRPYLGDQDVAFSYRQQTGKGTTLFSFSLQLPESFPSLL
DDDGYLSFPNLSETNLLPQSLQHYLPIRSPSLVPCFLFIFFFLLSASFSVPYALTLSFPL
ALCLCYLEPKAASLSASLDNDPSDSSEEETDSERTDTAADGETTATESDQEEDAELKAQE
LEKTQDDLMKHQTNISELKRTFLETSTDTAVTNEWEKRLSTSPVRLAARQEDAPMIEPLV
PEETKQSSGEKLMDGSEIFSLLESARKPTEFIGGVTSTSQSWVQKMETKTESSGIETEPT
VHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEG
AKEEGGEEVAKAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGS
VSPGGVKLEISTKEVPVVHTETKTITYESSQVDPGTDLEPGVLMSAQTITSETTSTTTTT
HITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEI
TPEDGED
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgaatctggatcagactcggaatccaagccggaccaggaggccgagccccag
gaggcggcgggggcgcaggggcgcgcgggggcgcccgtgccggagccgcccaaggaggag
cagcagcaggccctggagcagttcgccgccgctgcagcgcacagcaccccggtgcggagg
gaggtcactgacaaggaacaggagtttgctgccagggctgcaaaacagctcgaatatcag
caattagaagacgataaactttctcagaaatcatctagcagtaaactctctcggtctcca
ttaaagattgtcaaaaagcctaaaagcatgcagtgcaaagtgatacttctcgatggatca
gaatatacctgtgatgtagagaaacgctccagaggacaagtgctgtttgataaagtgtgt
gaacacttgaacttgctagagaaagactactttgggcttacgtatcgagatgctgaaaac
cagaagaattggttggaccctgctaaggaaataaaaaaacaggttcgaagtggtgcttgg
cacttttcatttaatgtgaaattttatccaccagaccctgcccaactatctgaagatatc
accaggtactacctctgcttgcagttgcgagatgacatcgtgtccggaaggctgccctgc
tcctttgttaccctggccttgctgggctcctacactgtccagtcagagctcggagactat
gacccagatgaatgtgggagcgattacattagtgagttccgctttgcaccaaaccacact
aaagaactggaagacaaagtgatcgagctgcacaagagccacagaggaatgacgccagca
gaagcagagatgcatttcttggaaaatgccaaaaaattatcaatgtatggggtagattta
catcatgctaaggactcagaaggggtagaaattatgttaggagtttgtgcaagtggtctg
ttgatatatcgcgaccggctgcgaataaacagatttgcctggcccaaggttctaaagatt
tcatacaaacggaacaacttttacattaagatccggccgggagagtttgaacaatttgaa
agcaccattgggtttaagctgccaaaccatcgagctgccaagcgtttatggaaagtatgt
gttgagcatcatacatttttcagactactgttaccagaagcacctcccaagaaattccta
accttgggttccaagtttcgttatagtggcaggacacaagcgcaaacgagaagagccagt
gcgttgatagatcgcccagcaccttactttgaacgctcatccagcaaacgttataccatg
tctcgcagcttggatggagaggttggtactggccagtacgccacaacaaaaggcatctct
cagaccaacttgatcaccactgtgactccggagaagaaggctgaggaggagcgggacgag
gaagaggacaaacggaggaagggggaagaagtcacgcccatctcggccatccggcacgag
ggaaagtcacctgggcttggcactgactcatgtcccttgtcacccccatccacccattgt
gcccccacatctcccacagagctccgtaggaggtgtaaggagaatgactgcaaactgcca
ggttatgagccgtccagagctgagcacctgcctggagagcccgccttggactctgatggc
ccagggaggccttacctaggggatcaagatgtggcttttagctacagacagcaaactggc
aaggggaccaccctgttctccttctccttgcagctccctgagtcattcccctccctccta
gatgatgatggatacctctctttccccaacctttctgaaaccaacctcctgccccagagc
ttgcagcattacctcccgatccgctcaccgtcccttgtgccctgtttcctcttcatcttt
ttctttctgctgtctgcctccttctcagtgccatacgctctcactctctccttccctctg
gctctgtgcctctgctacctggagcccaaggcggcctccttgagcgcctccctagacaat
gacccgagtgacagttcagaggaagagactgacagtgagcgcacggacaccgcagccgac
ggggagaccactgccactgagtcggaccaggaggaagatgcagagctcaaggcacaggag
ctagaaaaaactcaagatgacctgatgaaacatcaaaccaacattagcgagctgaaaaga
accttcttagaaacctcaacagacactgccgtaacgaatgaatgggagaagaggctttcc
acctcccccgtgcgactggccgccaggcaggaggatgcccccatgatcgaaccacttgtc
cctgaagagactaagcagtcttctggggaaaagctcatggatggctctgaaatcttcagt
ttattagagtctgcgcgaaaaccaacagaattcataggaggggttacttctacttctcaa
agctgggttcagaaaatggaaaccaagacggagtccagtggaatagagacggaacccacc
gtgcaccacctgccgcttagcactgagaaggtggtgcaggagaccgtgttggtggaggag
cggcgtgtggtgcacgcgagtggggatgcttcttactcggcgggagacagcggggatgct
gcagcacagcccgcattcacaggcattaaagggaaagagggctctgccttgacggagggg
gctaaagaggaaggaggggaggaggtcgctaaagctgtcctggaacaggaagagacagcc
gctgcttcccgtgagcgacaagaggagcagagtgcagccatccacatttcagaaactttg
gaacaaaaacctcattttgagtcctcaacggtgaagacggaaaccatcagttttggcagt
gtttcaccgggaggagtaaagctagaaatttccacgaaggaagtgccagtagttcacacc
gaaaccaaaaccatcacatatgaatcatcacaggtcgatccaggcacagatctggagcca
ggcgtgctgatgagtgcacagacgatcacatctgaaaccaccagtaccaccaccactacg
cacatcaccaaaactgtgaaagggggcatttcagagacaagaattgagaagcgaatagtc
atcacgggggatgcagacattgaccatgaccaggcgctggctcaggcaattaaagaggcc
aaagagcagcaccctgacatgtcagtgaccaaagtagtggtccataaagagacagagatc
acaccagaagatggagaggattga

DBGET integrated database retrieval system