KEGG   Homo sapiens (human): 2316Help
Entry
2316              CDS       T01001                                 

Gene name
FLNA, ABP-280, ABPX, CSBS, CVD1, FLN, FLN-A, FLN1, FMD, MNS, NHBP, OPD, OPD1, OPD2, XLVD, XMVD
Definition
(RefSeq) filamin A
  KO
K04437  
filamin
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Disease
H00270  
Periventricular nodular heterotopia (PVNH)
H00456  
Fronto-Otopalatodigital Osteodysplasia
H00577  
Syndromic X-linked mental retardation with epilepsy or seizures
H00894  
FG syndrome (FGS)
H01276  
Chronic idiopathic intestinal pseudo-obstruction
H01740  
Macrothrombocytopenia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    2316 (FLNA)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    2316 (FLNA)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    2316 (FLNA)
  Infectious diseases
   05132 Salmonella infection
    2316 (FLNA)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     2316 (FLNA)
  Intermediate filaments
   Intermediate filament-binding proteins
    2316 (FLNA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   2316 (FLNA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P21333(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
Xq28
AA seq 2647 aa AA seqDB search
MSSSHSRAGQSAAGAAPGGGVDTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
SKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKL
PQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVTNAREAMQQADDWLGIPQ
VITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKK
RAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLF
AGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVI
QDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNP
SACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGF
EYYPMVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVE
AIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFM
ADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVE
ALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVA
KTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTP
RGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAK
AAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSP
FSVAVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKV
EPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGG
SAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF
ADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSE
AGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQC
YGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVE
YTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVET
RGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKV
PVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVV
DNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGV
PASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILI
KYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAG
KGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTA
LAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIK
KGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYV
DYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTC
SVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDL
SLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVIS
QSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDG
TCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHC
DLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQH
VPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSK
AEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSL
QESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVY
LIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAG
ALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPR
LVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTV
DCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGS
PYRVVVP
NT seq 7944 nt NT seq  +upstreamnt  +downstreamnt
atgagtagctcccactctcgggcgggccagagcgcagcaggcgcggctccgggcggcggc
gtcgacacgcgggacgccgagatgccggccaccgagaaggacctggcggaggacgcgccg
tggaagaagatccagcagaacactttcacgcgctggtgcaacgagcacctgaagtgcgtg
agcaagcgcatcgccaacctgcagacggacctgagcgacgggctgcggcttatcgcgctg
ttggaggtgctcagccagaagaagatgcaccgcaagcacaaccagcggcccactttccgc
caaatgcagcttgagaacgtgtcggtggcgctcgagttcctggaccgcgagagcatcaaa
ctggtgtccatcgacagcaaggccatcgtggacgggaacctgaagctgatcctgggcctc
atctggaccctgatcctgcactactccatctccatgcccatgtgggacgaggaggaggat
gaggaggccaagaagcagacccccaagcagaggctcctgggctggatccagaacaagctg
ccgcagctgcccatcaccaacttcagccgggactggcagagcggccgggccctgggcgcc
ctggtggacagctgtgccccgggcctgtgtcctgactgggactcttgggacgccagcaag
cccgttaccaatgcgcgagaggccatgcagcaggcggatgactggctgggcatcccccag
gtgatcacccccgaggagattgtggaccccaacgtggacgagcactctgtcatgacctac
ctgtcccagttccccaaggccaagctgaagccaggggctcccttgcggcccaaactgaac
ccgaagaaagcccgtgcctacgggccaggcatcgagcccacaggcaacatggtgaagaag
cgggcagagttcactgtggagaccagaagtgctggccagggagaggtgctggtgtacgtg
gaggacccggccggacaccaggaggaggcaaaagtgaccgccaataacgacaagaaccgc
accttctccgtctggtacgtccccgaggtgacggggactcataaggttactgtgctcttt
gctggccagcacatcgccaagagccccttcgaggtgtacgtggataagtcacagggtgac
gccagcaaagtgacagcccaaggtcccggcctggagcccagtggcaacatcgccaacaag
accacctactttgagatctttacggcaggagctggcacgggcgaggtcgaggttgtgatc
caggaccccatgggacagaagggcacggtagagcctcagctggaggcccggggcgacagc
acataccgctgcagctaccagcccaccatggagggcgtccacaccgtgcacgtcacgttt
gccggcgtgcccatccctcgcagcccctacactgtcactgttggccaagcctgtaacccg
agtgcctgccgggcggttggccggggcctccagcccaagggtgtgcgggtgaaggagaca
gctgacttcaaggtgtacacaaagggcgctggcagtggggagctgaaggtcaccgtgaag
ggccccaagggagaggagcgcgtgaagcagaaggacctgggggatggcgtgtatggcttc
gagtattaccccatggtccctggaacctatatcgtcaccatcacgtggggtggtcagaac
atcgggcgcagtcccttcgaagtgaaggtgggcaccgagtgtggcaatcagaaggtacgg
gcctggggccctgggctggagggcggcgtcgttggcaagtcagcagactttgtggtggag
gctatcggggacgacgtgggcacgctgggcttctcggtggaagggccatcgcaggctaag
atcgaatgtgacgacaagggcgacggctcctgtgatgtgcgctactggccgcaggaggct
ggcgagtatgccgttcacgtgctgtgcaacagcgaagacatccgcctcagccccttcatg
gctgacatccgtgacgcgccccaggacttccacccagacagggtgaaggcacgtgggcct
ggattggagaagacaggtgtggccgtcaacaagccagcagagttcacagtggatgccaag
cacggtggcaaggccccacttcgggtccaagtccaggacaatgaaggctgccctgtggag
gcgttggtcaaggacaacggcaatggcacttacagctgctcctacgtgcccaggaagccg
gtgaagcacacagccatggtgtcctggggaggcgtcagcatccccaacagccccttcagg
gtgaatgtgggagctggcagccaccccaacaaggtcaaagtatacggccccggagtagcc
aagacagggctcaaggcccacgagcccacctacttcactgtggactgcgccgaggctggc
cagggggacgtcagcatcggcatcaagtgtgcccctggagtggtaggccccgccgaagct
gacatcgacttcgacatcatccgcaatgacaatgacaccttcacggtcaagtacacgccc
cggggggctggcagctacaccattatggtcctctttgctgaccaggccacgcccaccagc
cccatccgagtcaaggtggagccctctcatgacgccagtaaggtgaaggccgagggccct
ggcctcagtcgcactggtgtcgagcttggcaagcccacccacttcacagtaaatgccaaa
gctgctggcaaaggcaagctggacgtccagttctcaggactcaccaagggggatgcagtg
cgagatgtggacatcatcgaccaccatgacaacacctacacagtcaagtacacgcctgtc
cagcagggtccagtaggcgtcaatgtcacttatggaggggatcccatccctaagagccct
ttctcagtggcagtatctccaagcctggacctcagcaagatcaaggtgtctggcctggga
gagaaggtggacgttggcaaagaccaggagttcacagtcaaatcaaagggtgctggtggt
caaggcaaagtggcatccaagattgtgggcccctcgggtgcagcggtgccctgcaaggtg
gagccaggcctgggggctgacaacagtgtggtgcgcttcctgccccgtgaggaagggccc
tatgaggtggaggtgacctatgacggcgtgcccgtgcctggcagcccctttcctctggaa
gctgtggcccccaccaagcctagcaaggtgaaggcgtttgggccggggctgcagggaggc
agtgcgggctcccccgcccgcttcaccatcgacaccaagggcgccggcacaggtggcctg
ggcctgacggtggagggcccctgtgaggcgcagctcgagtgcttggacaatggggatggc
acatgttccgtgtcctacgtgcccaccgagcccggggactacaacatcaacatcctcttc
gctgacacccacatccctggctccccattcaaggcccacgtggttccctgctttgacgca
tccaaagtcaagtgctcaggccccgggctggagcgggccaccgctggggaggtgggccaa
ttccaagtggactgctcgagcgcgggcagcgcggagctgaccattgagatctgctcggag
gcggggcttccggccgaggtgtacatccaggaccacggtgatggcacgcacaccattacc
tacattcccctctgccccggggcctacaccgtcaccatcaagtacggcggccagcccgtg
cccaacttccccagcaagctgcaggtggaacctgcggtggacacttccggtgtccagtgc
tatgggcctggtattgagggccagggtgtcttccgtgaggccaccactgagttcagtgtg
gacgcccgggctctgacacagaccggagggccgcacgtcaaggcccgtgtggccaacccc
tcaggcaacctgacggagacctacgttcaggaccgtggcgatggcatgtacaaagtggag
tacacgccttacgaggagggactgcactccgtggacgtgacctatgacggcagtcccgtg
cccagcagccccttccaggtgcccgtgaccgagggctgcgacccctcccgggtgcgtgtc
cacgggccaggcatccaaagtggcaccaccaacaagcccaacaagttcactgtggagacc
aggggagctggcacgggcggcctgggcctggctgtagagggcccctccgaggccaagatg
tcctgcatggataacaaggacggcagctgctcggtcgagtacatcccttatgaggctggc
acctacagcctcaacgtcacctatggtggccatcaagtgccaggcagtcctttcaaggtc
cctgtgcatgatgtgacagatgcgtccaaggtcaagtgctctgggcccggcctgagccca
ggcatggttcgtgccaacctccctcagtccttccaggtggacacaagcaaggctggtgtg
gccccattgcaggtcaaagtgcaagggcccaaaggcctggtggagccagtggacgtggta
gacaacgctgatggcacccagaccgtcaattatgtgcccagccgagaagggccctacagc
atctcagtactgtatggagatgaagaggtaccccggagccccttcaaggtcaaggtgctg
cctactcatgatgccagcaaggtgaaggccagtggccccgggctcaacaccactggcgtg
cctgccagcctgcccgtggagttcaccatcgatgcaaaggacgccggggagggcctgctg
gctgtccagatcacggatcccgaaggcaagccgaagaagacacacatccaagacaaccat
gacggcacgtatacagtggcctacgtgccagacgtgacaggtcgctacaccatcctcatc
aagtacggtggtgacgagatccccttctccccgtaccgcgtgcgtgccgtgcccaccggg
gacgccagcaagtgcactgtcacagtgtcaatcggaggtcacgggctaggtgctggcatc
ggccccaccattcagattggggaggagacggtgatcactgtggacactaaggcggcaggc
aaaggcaaagtgacgtgcaccgtgtgcacgcctgatggctcagaggtggatgtggacgtg
gtggagaatgaggacggcactttcgacatcttctacacggccccccagccgggcaaatac
gtcatctgtgtgcgctttggtggcgagcacgtgcccaacagccccttccaagtgacggct
ctggctggggaccagccctcggtgcagccccctctacggtctcagcagctggccccacag
tacacctacgcccagggcggccagcagacttgggccccggagaggcccctggtgggtgtc
aatgggctggatgtgaccagcctgaggccctttgaccttgtcatccccttcaccatcaag
aagggcgagatcacaggggaggttcggatgccctcaggcaaggtggcgcagcccaccatc
actgacaacaaagacggcaccgtgaccgtgcggtatgcacccagcgaggctggcctgcac
gagatggacatccgctatgacaacatgcacatcccaggaagccccttgcagttctatgtg
gattacgtcaactgtggccatgtcactgcctatgggcctggcctcacccatggagtagtg
aacaagcctgccaccttcaccgtcaacaccaaggatgcaggagaggggggcctgtctctg
gccattgagggcccgtccaaagcagaaatcagctgcactgacaaccaggatgggacatgc
agcgtgtcctacctgcctgtgctgccgggggactacagcattctagtcaagtacaatgaa
cagcacgtcccaggcagccccttcactgctcgggtcacaggtgacgactccatgcgtatg
tcccacctaaaggtcggctctgctgccgacatccccatcaacatctcagagacggatctc
agcctgctgacggccactgtggtcccgccctcgggccgggaggagccctgtttgctgaag
cggctgcgtaatggccacgtggggatttcattcgtgcccaaggagacgggggagcacctg
gtgcatgtgaagaaaaatggccagcacgtggccagcagccccatcccggtggtgatcagc
cagtcggaaattggggatgccagtcgtgttcgggtctctggtcagggccttcacgaaggc
cacacctttgagcctgcagagtttatcattgatacccgcgatgcaggctatggtgggctc
agcctgtccattgagggccccagcaaggtggacatcaacacagaggacctggaggacggg
acgtgcagggtcacctactgccccacagagccaggcaactacatcatcaacatcaagttt
gccgaccagcacgtgcctggcagccccttctctgtgaaggtgacaggcgagggccgggtg
aaagagagcatcacccgcaggcgtcgggctccttcagtggccaacgttggtagtcattgt
gacctcagcctgaaaatccctgaaattagcatccaggatatgacagcccaggtgaccagc
ccatcgggcaagacccatgaggccgagatcgtggaaggggagaaccacacctactgcatc
cgctttgttcccgctgagatgggcacacacacagtcagcgtgaagtacaagggccagcac
gtgcctgggagccccttccagttcaccgtggggcccctaggggaagggggagcccacaag
gtccgagctgggggccctggcctggagagagctgaagctggagtgccagccgaattcagt
atctggacccgggaagctggtgctggaggcctggccattgctgtcgagggccccagcaag
gctgagatctcttttgaggaccgcaaggacggctcctgtggtgtggcttatgtggtccag
gagccaggtgactacgaagtctcagtcaagttcaacgaggaacacattcccgacagcccc
ttcgtggtgcctgtggcttctccgtctggcgacgcccgccgcctcactgtttctagcctt
caggagtcagggctaaaggtcaaccagccagcctcttttgcagtcagcctgaacggggcc
aagggggcgatcgatgccaaggtgcacagcccctcaggagccctggaggagtgctatgtc
acagaaattgaccaagataagtatgctgtgcgcttcatccctcgggagaatggcgtttac
ctgattgacgtcaagttcaacggcacccacatccctggaagccccttcaagatccgagtt
ggggagcctgggcatggaggggacccaggcttggtgtctgcttacggagcaggtctggaa
ggcggtgtcacagggaacccagctgagttcgtcgtgaacacgagcaatgcgggagctggt
gccctgtcggtgaccattgacggcccctccaaggtgaagatggattgccaggagtgccct
gagggctaccgcgtcacctatacccccatggcacctggcagctacctcatctccatcaag
tacggcggcccctaccacattgggggcagccccttcaaggccaaagtcacaggcccccgt
ctcgtcagcaaccacagcctccacgagacatcatcagtgtttgtagactctctgaccaag
gccacctgtgccccccagcatggggccccgggtcctgggcctgctgacgccagcaaggtg
gtggccaagggcctggggctgagcaaggcctacgtaggccagaagagcagcttcacagta
gactgcagcaaagcaggcaacaacatgctgctggtgggggttcatggcccaaggaccccc
tgcgaggagatcctggtgaagcacgtgggcagccggctctacagcgtgtcctacctgctc
aaggacaagggggagtacacactggtggtcaaatggggggacgagcacatcccaggcagc
ccctaccgcgttgtggtgccctga

KEGG   Homo sapiens (human): 2317Help
Entry
2317              CDS       T01001                                 

Gene name
FLNB, ABP-278, ABP-280, AOI, FH1, FLN-B, FLN1L, LRS1, SCT, TABP, TAP
Definition
(RefSeq) filamin B
  KO
K04437  
filamin
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Disease
H00461  
FLNB-related disorders
H00499  
Spondylocarpotarsal synostosis syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    2317 (FLNB)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    2317 (FLNB)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    2317 (FLNB)
  Infectious diseases
   05132 Salmonella infection
    2317 (FLNB)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     2317 (FLNB)
  Intermediate filaments
   Intermediate filament-binding proteins
    2317 (FLNB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   2317 (FLNB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O75369(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
3p14.3
AA seq 2602 aa AA seqDB search
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAK
GPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKP
MQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIRETTDFKVDTK
AAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGC
IVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGK
DQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTY
DGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVL
QSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADE
EIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQE
GKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLAT
GPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAK
PGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMN
GLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHI
KYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEG
PSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKL
GSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK
NGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVE
GPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESIT
RTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQ
EMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTRE
AGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPV
IAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEP
DKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTG
IQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPN
HIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGA
GLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGD
YVLAVKWGEEHIPGSPFHVTVP
NT seq 7809 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaaccgagaaggatctagctgaggacgcgccttggaagaagatccagcagaac
acgttcacacgctggtgcaacgagcacctcaagtgcgtgaacaaacgcatcggcaacctg
cagaccgacctgagcgacgggctgcggctcatcgcgctgctcgaggtgctcagccagaag
cgcatgtaccgcaagtaccatcagcggcccacctttcgccagatgcagctcgagaatgtg
tccgtggcgctcgagttcctggaccgtgagagcatcaagctcgtgtccatcgatagcaaa
gccattgtggatgggaacctgaagctcatcttgggtctggtgtggacgctgatcctccac
tactccatctccatgcccgtgtgggaggatgaaggggatgatgatgccaagaagcagacg
ccaaagcagaggctgctggggtggattcagaacaagatcccctacttgcccatcaccaac
tttaaccagaactggcaagacggcaaagccctgggagccctggtagacagctgtgctcca
ggtctgtgcccagactgggaatcctgggacccgcagaagcctgtggataatgcacgagaa
gccatgcagcaggcagatgactggctgggtgtcccacaggtcatcactcctgaagaaatc
attcacccggatgtggacgagcactcagttatgacttacctgtcccagttccccaaagcc
aagctcaagccgggggctcctctcaaacccaaactcaacccgaagaaagccagggcctat
ggcagaggaatcgagcccactggaaacatggtgaagcagccagccaagttcactgtggac
accatcagcgccgggcaaggagacgtgatggtgtttgttgaggacccagaagggaacaaa
gaggaggcacaagtgacccctgacagtgacaagaacaagacatactctgtggagtatctg
cccaaggtcaccgggctacacaaagtcacagtcctctttgcaggacagcacatctccaag
agcccatttgaagtgagtgttgacaaggcccagggagatgccagtaaagtcactgcaaaa
ggtccagggttggaagctgtagggaacatcgccaataagcccacctactttgacatctat
acggcaggagctggtgtgggtgacattggtgtggaggtggaagatccccaggggaagaac
accgtggagttgctcgtggaagacaaaggaaaccaggtgtatcgatgtgtgtacaaaccc
atgcagcctggccctcacgtggtcaagatcttctttgctggggacactattcctaagagt
cccttcgttgtgcaggttggggaagcctgcaatccaaatgcctgccgggccagtggccga
ggcctacaacccaaaggcgtccgtatccgggagaccacagatttcaaggttgacaccaaa
gctgcaggaagtggggagctcggtgtaaccatgaagggtcctaagggtctggaggagctg
gtgaagcagaaagactttctggatggggtctacgcattcgagtattaccccagcaccccg
gggagatacagcattgccatcacatgggggggacaccacattccaaagagcccctttgaa
gttcaagttggccctgaagcgggtatgcagaaagtccgtgcttggggccctgggctccat
ggtgggattgtcgggcggtcagcggacttcgtggtagaatccattggctctgaagtgggg
tctctggggtttgccattgaaggcccctctcaggcaaagattgagtacaacgaccagaat
gatggatcgtgtgatgtcaaatactggcccaaggagcctggcgaatatgctgttcacatc
atgtgtgacgacgaagacatcaaggacagcccgtacatggccttcatccacccagccacg
ggaggctacaaccctgatctggttcgagcatacgggccaggtttggagaaatctggatgc
attgtcaacaacctggccgagttcactgtggatcctaaggatgctggaaaagctccctta
aagatatttgctcaggatggggaaggccaacgcattgacatccagatgaagaaccggatg
gacggcacatatgcatgctcatacaccccggtgaaggccatcaagcacaccattgctgtg
gtctggggaggcgtgaacatcccgcacagcccctacagggtcaacatcgggcaaggtagc
catcctcagaaggtcaaagtgtttgggccaggtgtggagagaagtggtctgaaggcaaat
gaacctacacacttcacggtggactgtactgaggctggggaaggtgatgtcagtgttggc
attaagtgtgatgcccgggtgttaagtgaagatgaggaagacgtggattttgacattatt
cacaatgccaatgatacgttcacagtcaaatatgtgcctcctgctgctgggcgatacact
atcaaagttctctttgcatctcaggaaatccccgccagccctttcagagtcaaagttgac
ccttcccacgatgccagcaaagtgaaggcagaaggcccagggctcagcaaagcaggtgtg
gaaaatgggaaaccgacccacttcactgtctacaccaagggggctgggaaagccccgctc
aacgtgcagttcaacagccctcttcctggcgatgcagtgaaggatttggatatcatcgat
aattatgactactctcacacggttaaatatacacccacccaacagggcaacatgcaggtt
ctggtgacttacggtggcgatcccatccctaaaagccctttcactgtgggtgttgctgca
ccgctggatctgagcaagataaaactcaatgggctggaaaacagggtggaagttgggaag
gatcaggagttcaccgttgataccaggggggcaggaggccaggggaagctggacgtgaca
atcctcagcccctctcggaaggtcgtgccatgcctagtgacacctgtgacaggccgggag
aacagcacggccaagttcatccctcgggaggaggggctgtatgctgtagacgtgacctac
gatggacaccctgtgcccgggagcccctacacagtggaggcctcgctgccaccagatccc
agcaaggtgaaggcccacggtcccggcctcgaaggtggtctcgtgggcaagcctgccgag
ttcaccatcgataccaaaggagctggtactggaggtctgggcttaacggtggaaggtccg
tgcgaggccaaaatcgagtgctccgacaatggtgatgggacctgctccgtctcttacctt
cccacaaaacccggggagtacttcgtcaacatcctctttgaagaagtccacatacctggg
tctcccttcaaagctgacattgaaatgccctttgacccctctaaagtcgtggcatcgggg
ccaggtctcgagcacgggaaggtgggtgaagctggcctccttagcgtcgactgctcggaa
gcgggaccgggggccctgggcctggaagctgtctcggactcgggaacaaaagccgaagtc
agtattcagaacaacaaagatggcacctacgcggtgacctacgtgcccctgacggccggc
atgtacacgttgaccatgaagtatggtggcgaactcgtgccacacttccccgcccgggtc
aaggtggagcccgccgtggacaccagcaggatcaaagtctttggaccaggaatagaaggg
aaagatgtgttccgggaagctaccaccgactttacagttgactctcggccgctgacccag
gttgggggtgaccacatcaaggcccacattgccaacccctcaggggcctccaccgagtgc
tttgtcacagacaatgcggatgggacctaccaggtggaatacacaccctttgagaaaggt
ctccatgtagtggaggtgacatatgatgacgtgcctatcccaaacagtcccttcaaggtg
gctgtcactgaaggctgccagccatctagggtgcaagcccaaggacctggattgaaagag
gcctttaccaacaagcccaatgtcttcaccgtggttaccagaggcgcaggaattggtggg
cttggcataactgttgagggaccatcagagtcgaagataaattgcagagacaacaaggat
ggcagctgcagtgctgagtacattcctttcgcaccgggggattacgatgttaatatcaca
tatggaggagcccacatccccggcagccccttcagggttcctgtgaaggatgttgtggac
cccagcaaggtcaagattgccggccccgggctgggctcaggcgtccgagcccgtgtcctg
cagtccttcacggtggacagcagcaaggctggcctggctccgctggaagtgagggttctg
ggcccacgaggcttggtggagccagtgaacgtggtggacaatggagatggcacacacaca
gtaacctacaccccatctcaggagggaccttacatggtctcagttaaatatgctgatgaa
gagattcctcgcagtcccttcaaggtcaaggtccttcccacatatgatgccagcaaagtg
actgccagtggccccggccttagttcctatggtgtgcctgccagtctacctgtggacttt
gcaattgatgcccgagatgccggggaaggcctgcttgctgttcaaataacggaccaagaa
ggaaaacccaaaagagccattgtccatgacaataaagatggcacgtatgctgtcacctac
atccccgacaagactgggcgctatatgattggagtcacctacgggggtgacgacatccca
ctttctccttatcgcatccgagccacacagacgggtgatgccagcaagtgcctggccacg
ggtcctggaatcgcctccactgtgaaaactggcgaagaagtaggctttgtggttgatgcc
aagactgccgggaagggtaaagtgacctgcacggttctgaccccagatggcactgaggcc
gaggccgatgtcattgagaatgaagatggaacctatgacatcttctacacagctgccaag
ccgggcacatatgtgatctatgtgcgcttcggtggtgttgatattcctaacagccccttc
actgtcatggccacagatggggaagtcacagccgtggaggaggcaccggtaaatgcatgt
ccccctggattcaggccctgggtgaccgaagaggcctatgtcccagtgagtgacatgaac
ggcctgggatttaagccttttgacctggtcattccgtttgctgtcaggaaaggagaaatc
actggagaggtccacatgccttctgggaagacagccacacctgagattgtggacaacaag
gacggcacggtcactgttagatatgcccccactgaggtcgggctccatgagatgcacatc
aaatacatgggcagccacatccctgagagcccactccagttctacgtgaactaccccaac
agtggaagtgtttctgcatacggtccaggcctcgtgtatggagtggccaacaaaactgcc
accttcaccatcgtcacagaggatgcaggagaaggtggtctggacttggctattgagggc
ccctcaaaagcagaaatcagctgcattgacaataaagatgggacatgcacagtgacctac
ctgccgactctgccaggcgactacagcattctggtcaagtacaatgacaagcacatccct
ggcagccccttcacagccaagatcacagatgacagcaggcggtgctcccaggtgaagttg
ggctcagccgctgacttcctgctcgacatcagtgagactgacctcagcagcctgacggcc
agcattaaggccccatctggccgagacgagccctgtctcctgaagaggctgcccaacaac
cacattggcatctccttcatcccccgggaagtgggcgaacatctggtcagcatcaagaaa
aatggcaaccatgtggccaacagccccgtgtctatcatggtggtccagtcggagattggt
gacgcccgccgagccaaagtctatggccgcggcctgtcagaaggccggactttcgagatg
tctgacttcatcgtggacacaagggatgcaggttatggtggcatatccttggcggtggaa
ggccccagcaaagtggacatccagacggaggacctggaagatggcacctgcaaagtctcc
tacttccctaccgtgcctggggtttatatcgtctccaccaaattcgctgacgagcacgtg
cctgggagcccatttaccgtgaagatcagtggggagggaagagtcaaagagagcatcacc
cgcaccagtcgggccccgtccgtggccactgtcgggagcatttgtgacctgaacctgaaa
atcccagaaatcaacagcagtgatatgtcggcccacgtcaccagcccctctggccgtgtg
actgaggcagagattgtgcccatggggaagaactcacactgcgtccggtttgtgccccag
gagatgggcgtgcacacggtcagcgtcaagtaccgtgggcagcacgtcaccggcagcccc
ttccagttcaccgtggggccacttggtgaaggaggcgcccacaaggtgcgggcaggaggc
cctggcctggagagaggagaagcgggagtcccagctgagttcagcatttggacccgggaa
gcaggcgctggaggcctctccatcgctgttgagggccccagtaaggccgagattacattc
gatgaccataaaaatgggtcgtgcggtgtatcttatattgcccaagagcctggtaactac
gaggtgtccatcaagttcaatgatgagcacatcccggaaagcccctacctggtgccggtc
atcgcaccctccgacgacgcccgccgcctcactgttatgagccttcaggaatcgggatta
aaagttaaccagccagcatcctttgctataaggttgaatggcgcaaaaggcaagattgat
gcaaaggtgcacagcccctctggagccgtggaggagtgccacgtgtctgagctggagcca
gataagtatgctgttcgcttcatccctcatgagaatggtgtccacaccatcgatgtcaag
ttcaatgggagccacgtggttggaagccccttcaaagtgcgcgttggggagcctggacaa
gcggggaaccctgccctggtgtccgcctatggcacgggactcgaagggggcaccacaggt
atccagtcggaattctttattaacaccacccgagcaggtccagggacattatccgtcacc
atcgaaggcccatccaaggttaaaatggattgccaggaaacacctgaagggtacaaagtc
atgtacacccccatggctcctggtaactacctgatcagcgtcaaatacggtgggcccaac
cacatcgtgggcagtcccttcaaggccaaggtgacaggccagcgtctagttagccctggc
tcagccaacgagacctcatccatcctggtggagtcagtgaccaggtcgtctacagagacc
tgctatagcgccattcccaaggcatcctcggacgccagcaaggtgacctctaagggggca
gggctctcaaaggcctttgtgggccagaagagttccttcctggtggactgcagcaaagct
ggctccaacatgctgctgatcggggtccatgggcccaccaccccctgcgaggaggtctcc
atgaagcatgtaggcaaccagcaatacaacgtcacatacgtcgtcaaggagaggggcgat
tatgtgctggctgtgaagtggggggaggaacacatccctggcagcccttttcatgtcaca
gtgccttaa

KEGG   Homo sapiens (human): 2318Help
Entry
2318              CDS       T01001                                 

Gene name
FLNC, ABP-280, ABP280A, ABPA, ABPL, CMH26, FLN2, MFM5, MPD4, RCM5
Definition
(RefSeq) filamin C
  KO
K04437  
filamin
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Disease
H00595  
Myofibrillar myopathies (MFM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    2318 (FLNC)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    2318 (FLNC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    2318 (FLNC)
  Infectious diseases
   05132 Salmonella infection
    2318 (FLNC)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     2318 (FLNC)
  Intermediate filaments
   Intermediate filament-binding proteins
    2318 (FLNC)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   2318 (FLNC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q14315(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
7q32.1
AA seq 2725 aa AA seqDB search
MMNNSGYSDAGLGLGDETDEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTDL
QRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDSK
AIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPITN
FNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEEI
VDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFTV
QTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNIE
RSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGR
RDTVEVALEDKGDSTFRCTYRPAMEGPHTVHVAFAGAPITRSPFPVHVSEACNPNACRAS
GRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYPV
VPGKYVVTITWGGYAIPRSPFEVQVSPEAGVQKVRAWGPGLETGQVGKSADFVVEAIGTE
VGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHILP
APPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVIP
NGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGLK
ANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGR
YTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGKA
KLDVQFAGTAKGEVVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVNV
APPLDLSKIKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGG
AEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGTP
APFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAHI
PGSPFKATIRPVFDPSKVRASGPGLERGKVGEAATFTVDCSEAGEAELTIEILSDAGVKA
EVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGVKVSGPGV
EPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYE
EGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAGT
GGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKDV
VDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDGT
HTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLPV
EFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGDE
IPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTC
TVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPLPH
EEEPSEVPQLRQPYAPPRPGARPTHWATEEPVVPVEPMESMLRPFNLVIPFAVQKGELTG
EVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSR
HVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLP
TAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSQLTAS
IRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGD
ASKVRVWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTY
CPTEPGTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKI
PGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPA
VFGDFLGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKVEAAEIVEGEDSAYSVRFVP
QEMGPHTVAVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTR
EAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVP
VASLSDDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSELD
SDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTT
GVSSEFIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGP
QHIVGSPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVT
RGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKE
KGDYILIVKWGDESVPGSPFKVKVP
NT seq 8178 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaacagcggctactcagacgccggcctcggcctgggcgatgagacagacgag
atgccgtccacggagaaggacctggcggaggacgcgccgtggaagaagatccagcagaac
acattcacgcgctggtgcaatgagcacctcaagtgcgtgggcaagcgcctgaccgacctg
cagcgcgacctcagcgacgggctccggctcatcgcgctgctcgaggtgctcagccagaag
cgcatgtaccgcaagttccatccgcgccccaacttccgccaaatgaagctggagaacgtg
tccgtggccctcgagttcctcgagcgcgagcacatcaagctcgtgtccatagacagcaag
gccatcgtggatgggaacctgaagctgatcctgggcctgatctggacgctgatcctgcac
tactccatctccatgcccatgtgggaggatgaagatgatgaggatgcccgcaaacagacg
cccaagcagcggctgcttggctggatccagaacaaggtgccccagctgcccatcaccaac
ttcaaccgtgactggcaggacggcaaagctctgggcgccctggtggacaactgcgccccc
ggtctctgccccgactgggaggcctgggaccccaaccagcccgtggagaacgcccgggag
gccatgcagcaggccgacgactggcttggggtgccccaggtcattgcccctgaggagatt
gtggaccccaacgtggatgagcattctgttatgacctacctgtcccagttccccaaggcc
aagctcaaacctggtgcccctgttcgatccaagcagctgaaccccaagaaagccatcgcc
tatgggcctggcatcgagccacagggcaacaccgtgctgcagcctgcccacttcaccgtg
cagacggtggacgcgggcgtgggcgaggtgctggtctacatcgaggaccctgaaggccac
accgaggaggctaaggtggttcccaacaatgacaaggatcgcacctatgctgtctcctat
gtgcccaaggtcgctgggttacacaaggtgaccgtgctctttgctggccagaacattgaa
cgcagtccctttgaggtgaacgtgggcatggccctgggagatgccaacaaggtgtcagcc
cgtggccctggcctggaacctgtgggcaatgtggccaacaaacccacctactttgacatc
tacactgcgggggccggcactggcgatgttgctgtggtgatcgtggacccacagggccgg
cgggacacagtggaggtggccctggaggacaagggtgacagcacgttccgctgcacatac
agacctgccatggaggggccacataccgtgcatgtggcctttgcgggtgcccccatcacc
cgcagtcccttccctgtccatgtgtcggaagcctgtaaccccaacgcctgccgcgcctct
gggcgaggcctgcagcccaagggtgttcgcgtgaaagaggtggctgacttcaaggtgttt
accaagggtgccggcagcggggagctcaaggtcacggtcaaggggccaaagggcacagag
gagccagtgaaggtgcgggaggctggggatggtgtgttcgagtgcgagtactacccggtg
gtgcctgggaagtatgtggtgaccatcacgtggggcggctacgccatccctcgcagcccc
tttgaggtacaggtgagcccagaggcaggagtgcaaaaggtccgggcctggggtcctggt
ttggagactggccaggtgggcaagtcagccgattttgtggtggaagccattggcaccgag
gtggggacactgggcttctccatcgaggggccctcacaagccaagatcgaatgtgacgac
aagggggatggctcctgcgatgtgcggtactggcccacggagcctggggagtacgctgtg
cacgtcatctgtgacgatgaggacatccgagactcacccttcattgcccacatcctgccc
gccccacctgactgcttcccagataaggtgaaggcctttgggcctggcctggagcctacc
ggctgcatcgtggacaagcccgctgagttcaccattgatgctcgtgcagctggcaaggga
gacctgaagctctatgcccaggacgccgacggctgtcccatcgacatcaaggtgatcccc
aacggcgacggcaccttccgctgctcctacgtgcccaccaagcccattaagcacaccatc
atcatctcctggggaggcgtaaacgtgcccaagagccccttccgggtgaacgtgggcgag
ggcagccaccccgagcgggtaaaggtgtacggccccggagtggagaagacaggcctcaag
gccaatgagcccacctacttcacggtggactgcagcgaggcggggcaaggcgacgtgagc
atcggcatcaagtgcgccccaggcgtggtgggccctgcagaggctgacattgacttcgac
atcatcaagaatgacaacgacaccttcaccgtcaagtacacgccaccaggggcgggccgc
tacaccatcatggtgctgtttgccaaccaggagatccccgccagccccttccacatcaag
gtggacccatcccacgatgccagcaaagtcaaggccgagggccctgggctgaatcgcaca
ggtgtggaagtcgggaagcccacccacttcacggtgctgaccaagggagccggcaaggcc
aagctggatgtgcagtttgcagggacagccaagggcgaggttgtgcgggactttgagatc
atagacaaccatgactactcctacactgtcaagtacaccgctgtccagcagggcaacatg
gcagtgacagtgacttatggcggggaccctgtccccaagagcccctttgtggtgaatgtg
gcacccccgctggacctcagcaaaatcaaagttcagggccttaatagcaaggtggctgtg
ggacaggaacaagcattctctgtgaacacacgaggggctggcggtcagggccaactggat
gtgcggatgacttcgccctctcgccggcccatcccctgcaagctggagccaggcggtgga
gcggaagcccaggctgtgcgctacatgcccccggaggaggggccctacaaggtggatatc
acctacgatggtcacccggtgcctggcagcccgtttgctgtggagggtgtcctgccccct
gatccctccaaggtctgtgcttatggcccgggtctcaagggtggactggtaggcaccccc
gcgccattctccatcgacaccaagggggctggcacaggtggcctggggctgaccgtagag
ggcccctgcgaggccaagatcgagtgccaggacaatggtgatggctcatgtgctgtcagc
tacctgcccacggagcctggcgagtacaccatcaacatcctgtttgctgaggcccacatc
cctggctcgcccttcaaagccaccattcggcctgtgtttgacccgagcaaggtgcgggcc
agtggaccgggcctggagcgcggcaaggtcggtgaggcagccaccttcactgtggactgc
tcagaggcaggcgaggcggagctgaccattgagatcctgtcggatgccggggtcaaggcc
gaggtgctgatccacaacaacgcggatggcacctaccacatcacctacagccctgccttc
cctggcacctacaccattaccatcaagtatggcgggcatcccgtgcccaaattccccacc
cgtgtccatgtgcagcctgcggtcgataccagtggcgtcaaggtctcagggcctggtgtt
gagccacacggtgtcctgcgggaggtgaccactgagttcactgtggatgcaagatcccta
acagccacaggcggcaaccacgtgacggctcgtgtgctcaacccctcgggggccaagaca
gacacctatgtgacagacaatggggacggcacctaccgagtgcagtacaccgcctacgag
gagggcgtgcatctggtggaggtcctgtatgatgaggtcgctgtgcccaagagccccttc
cgagtgggcgtgaccgagggctgtgatcccacccgcgtccgagccttcgggccaggcctg
gagggtggcttggtcaacaaggccaaccgattcactgtggagaccaggggagcgggcacc
gggggccttggcctagccatcgagggtccctcggaagccaagatgtcctgcaaggacaac
aaggatggtagctgcaccgtggagtacatccccttcactcctggagactatgacgtcaac
atcaccttcggggggcggcccatcccagggagcccgttccgcgtgccagtgaaggatgtg
gtggaccctgggaaggtgaagtgctcagggccagggctgggggctggtgtcagggcccgg
gttcctcagaccttcacagtggactgcagtcaagctggccgggcgcccctgcaggtggct
gtgctgggccccacaggtgtggccgagcctgtggaggtgcgggacaatggagatggcacc
cacactgtccactacaccccagccactgacgggccctacacggtagccgtcaagtatgct
gaccaggaggtgccacgcagccccttcaagatcaaggtcctcccagctcatgatgccagc
aaggtgcgggccagcggcccaggcctcaacgcctctggcatccctgccagcctgcctgtg
gagttcaccatcgacgcacgggacgcgggcgaggggttgctcactgtccagatcttggac
cccgagggtaagcccaagaaggccaacatccgggacaatggggatggcacgtacactgtg
tcctacctgccggacatgagtggccggtacaccatcaccatcaagtatggcggtgatgag
atcccctactcgcccttccgcatccatgctctgcccactggggatgccagcaagtgcctc
gtcacagtgtccattggaggccatggcctgggtgcctgcctgggccctcgaatccagatt
gggcaggagacggtgatcacggtggatgccaaggcagccggtgaggggaaggtgacatgc
acggtgtccacgccggatggggcagagctcgatgtggatgtggttgagaaccatgacggt
acctttgacatctactacacagcgcccgagccgggcaagtacgtcatcaccatccgcttc
gggggtgagcacatccccaacagccccttccacgtgctggcgtgtgaccccctgccgcac
gaggaggagccctctgaagtgccacagctgcgccagccctacgctcctccccggcccggc
gcccgccccacacactgggccacagaggagccagtggtgcctgtggagccaatggagtcc
atgctgaggcccttcaacctggtcatccccttcgcggtgcagaaaggggagctcacagga
gaggtgcggatgccctcggggaagacggcacggcccaacatcaccgacaacaaggacggc
accatcacggtgaggtatgcacccactgagaaaggcctgcaccagatggggatcaagtat
gacggcaaccacatccctgggagccccttacagttctatgtggatgccatcaacagccgc
catgtcagtgcctatgggccaggcctgagccatggcatggtcaacaagccagccaccttc
actattgtcaccaaagatgctggagaagggggtctgtcactggccgtggagggcccatcc
aaggcagagatcacctgtaaggacaacaaggatggcacctgcaccgtgtcctatctgccg
actgcgcctggagactacagcatcatcgtgcgcttcgatgacaagcacatcccggggagc
cccttcacagccaagatcacaggtgatgactccatgaggacctcacagctgaatgtgggc
acctccacggacgtgtcactgaagatcaccgagagtgatctgagccagctgaccgccagc
atccgtgccccctcgggcaacgaggagccctgcctgctgaagcgcctgcccaaccggcac
attgggatctccttcacccccaaggaggtcggggagcacgtggtgagcgtgcgcaagagt
ggcaagcatgtcaccaacagccccttcaagatcctggtggggccatctgagatcggggac
gccagcaaggtgcgggtctggggcaaggggctttccgagggacacacattccaggtggca
gagttcatcgtggacactcgcaatgcaggttatgggggcttggggctgagtattgaaggc
ccaagcaaggtggacatcaactgtgaggacatggaggacgggacatgcaaagtcacctac
tgccccaccgagcccggcacctacatcatcaacatcaagtttgctgacaagcacgtgcct
ggaagccccttcactgtgaaggtgaccggcgagggccgcatgaaggagagcatcacccgg
cggagacaggcaccttccatcgccaccatcggcagcacctgtgacctcaacctcaagatc
ccaggaaactggttccagatggtgtctgcccaggagcgcctgacacgcaccttcacacgc
agcagccacacctacacccgcacggagcgcacggagatcagcaagacgcggggcggggag
acaaagcgcgaggtgcgggtggaggagtccacccaggtcggcggggaccccttccctgct
gtgtttggggacttcctgggccgggagcgcctgggatccttcggcagcatcacccggcag
caggagggtgaggccagctctcaggacatgactgcacaggtgaccagcccatcgggcaag
gtggaagccgcagagatcgtcgagggcgaggacagcgcctacagcgtgcgctttgtgccc
caggaaatggggccccatacggtcgctgtcaagtaccgtggccagcacgtgcccggcagc
ccctttcagttcactgtggggccgctgggtgaaggtggtgcccacaaggtgcgggccgga
ggcacagggctggagcgaggtgtggccggcgtgccagccgagttcagcatctggacccgg
gaggctggcgctgggggcctgtccattgctgtggagggtcctagcaaagcggagattgca
tttgaggatcgcaaagatggctcctgcggcgtctcctatgtcgtccaggaaccaggtgac
tatgaggtctccatcaagttcaatgatgagcacatcccagacagcccctttgtggtgcct
gtggcctccctctcggatgacgctcgccgtctcactgtcaccagcctccaggagacgggg
ctcaaggtgaaccagccagcgtcctttgccgtgcagctgaacggtgcccggggcgtgatt
gatgcccgggtgcacacaccctcgggggctgtggaggagtgctacgtctctgagctggac
agtgacaagcacaccatccgcttcatcccccacgagaatggcgtccactccatcgatgtc
aagttcaacggtgcccacatccctggaagtcccttcaagatccgcgttggggagcagagc
caggctggggacccaggcttggtgtcagcctacggtcctgggctcgagggaggcactacc
ggtgtgtcatcagagttcatcgtgaacaccctgaatgccggctcgggggccttgtctgtc
accattgatggcccctccaaggtgcagctggactgtcgggagtgtcctgagggccatgtg
gtcacttatactcccatggcccctggcaactacctcattgccatcaagtacggtggcccc
cagcacatcgtgggcagccccttcaaggccaaggtcactggtccgaggctgtccggaggc
cacagccttcacgaaacatccacggttctggtggagactgtgaccaagtcctcctcaagc
cggggctccagctacagctccatccccaagttctcctcagatgccagcaaggtggtgact
cggggccctgggctgtcccaggccttcgtgggccagaagaactccttcaccgtggactgc
agcaaagcaggcaccaacatgatgatggtgggcgtgcacggccccaagaccccctgtgag
gaggtgtacgtgaagcacatggggaaccgggtgtacaatgtcacctacactgtcaaggag
aaaggggactacatcctcattgtcaagtggggtgacgaaagtgtccctggaagccccttc
aaagtcaaggtcccttga

DBGET integrated database retrieval system