KEGG   Homo sapiens (human): 23160Help
Entry
23160             CDS       T01001                                 

Gene name
WDR43, NET12, UTP5
Definition
(RefSeq) WD repeat domain 43
  KO
K14546  
U3 small nucleolar RNA-associated protein 5
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    23160 (WDR43)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   U3 small nucleolar RNA-associated proteins
    23160 (WDR43)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q15061(Tdark)
UniProt: 
Position
2p23.2
AA seq 677 aa AA seqDB search
MAAGGGGSCDPLAPAGVPCAFSPHSQAYFALASTDGHLRVWETANNRLHQEYVPSAHLSG
TCTCLAWAPARLQAKESPQRKKRKSEAVGMSNQTDLLALGTAVGSILLYSTVKGELHSKL
ISGGHDNRVNCIQWHQDSGCLYSCSDDKHIVEWNVQTCKVKCKWKGDNSSVSSLCISPDG
KMLLSAGRTIKLWVLETKEVYRHFTGHATPVSSLMFTTIRPPNESQPFDGITGLYFLSGA
VHDRLLNVWQVRSENKEKSAVMSFTVTDEPVYIDLTLSENKEEPVKLAVVCRDGQVHLFE
HILNGYCKKPLTSNCTIQIATPGKGKKSTPKPIPILAAGFCSDKMSLLLVYGSWFQPTIE
RVALNSREPHMCLVRDISNCWAPKVETAITKVRTPVMNSEAKVLVPGIPGHHAAIKPAPP
QTEQVESKRKSGGNEVSIEERLGAMDIDTHKKGKEDLQTNSFPVLLTQGLESNDFEMLNK
VLQTRNVNLIKKTVLRMPLHTIIPLLQELTKRLQGHPNSAVLMVQWLKCVLTVHASYLST
LPDLVPQLGTLYQLMESRVKTFQKLSHLHGKLILLITQVTASEKTKGATSPGQKAKLVYE
EESSEEESDDEIADKDSEDNWDEDEEESESEKDEDVEEEDEDAEGKDEENGEDRDTASEK
ELNGDSDLDPENESEEE
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgggcggcggcggtagctgcgaccccctggcccctgctggggtcccttgcgcc
ttctccccgcacagccaggcctacttcgctttggcctctaccgacggtcacttacgagta
tgggagacggccaacaaccggctgcaccaggagtacgtgccttccgcgcacctcagtggt
acctgcacctgtctggcctgggcgccagcgcggctgcaggccaaggaaagtccccagagg
aaaaaaaggaaatcagaagctgtaggaatgagtaaccagactgacttattggctcttggc
acagcagttggtagcattttattatacagcacagtaaaaggagagttacacagtaaatta
ataagtggtggacatgacaacagagtcaactgcatacagtggcatcaagacagtggctgt
ttatatagttgttcagatgataaacatattgtggaatggaacgtacagacatgcaaagta
aagtgcaaatggaaaggcgacaatagcagtgtcagttccctatgtatcagcccagatgga
aagatgttgctttcagctggtcgaacaatcaaactatgggttttggagaccaaagaagtc
tacaggcatttcacaggacatgcaacgccagtttcgtcactgatgttcactaccatcaga
cctcctaatgagagccagccctttgatggaattacaggtctttatttcttatctggagca
gtacatgaccggttacttaatgtctggcaggtccgatcagaaaacaaagaaaagagtgca
gtgatgtcatttacagttaccgatgaacctgtctatattgacttaactttgtcagaaaac
aaagaagagcctgtcaagttggctgttgtttgcagagatggtcaagtccatctttttgaa
cacatattaaatgggtactgcaaaaagcctttgacttcaaactgcacaattcagatagca
acacctgggaaaggcaagaagtcaacaccaaaacccatccctattctagctgctggtttt
tgctcagacaaaatgtcattgttgcttgtatatggcagttggtttcagcctactattgag
cgagtggctttaaactccagagaacctcatatgtgtttagtaagagatatttcaaactgc
tgggcccccaaagtagaaacagctataacaaaggtgaggacaccagtgatgaattctgaa
gcaaaagttctggtgcctgggattcctggtcatcatgcagctatcaagcccgctcctcca
caaaccgagcaagtagagagcaagaggaagtcagggggaaatgaggttagcattgaagaa
cgtctgggagcaatggatatagacacacacaaaaaaggaaaggaagacctccagacgaat
agctttccagttcttcttacccagggcttagaaagtaacgattttgaaatgctaaataaa
gtacttcaaactaggaatgtaaaccttataaagaagactgtattaaggatgcccctgcat
actattattccgttgttacaagagcttacaaagaggttacaaggacatcctaatagtgct
gtgctaatggttcagtggctaaaatgtgtgttaacagttcatgcatcatacctgtccacg
ttgcctgacctggtaccccagctggggacactctaccagttaatggaaagcagagtcaaa
acttttcagaaactttcacaccttcatggaaagcttattcttctaattacacaagtaaca
gcatcagagaagacaaagggagcaacttcccctggacagaaggcaaagttggtgtatgaa
gaagagtcttctgaagaggagtctgatgatgaaatagcagataaggattctgaagataat
tgggatgaagatgaggaggagagtgaaagtgaaaaagatgaggacgttgaagaggaagat
gaggatgccgaaggaaaagatgaagaaaatggcgaggacagagatacagcaagtgaaaaa
gaattaaatggagattctgatttagatcctgaaaatgaaagtgaagaagaatga

DBGET integrated database retrieval system