KEGG   Homo sapiens (human): 23162Help
Entry
23162             CDS       T01001                                 

Gene name
MAPK8IP3, JIP3, JSAP1, SYD2, syd
Definition
mitogen-activated protein kinase 8 interacting protein 3
Orthology
K04436  
mitogen-activated protein kinase 8 interacting protein 3
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    23162 (MAPK8IP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.3
AA seq 1330 aa AA seqDB search
MMEIQMDEGGGVVVYQDDYCSGSVMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVV
NVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRRQAEEKFIEFEDALEQEKK
ELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIE
RSKMQQVGGNSQTESSLPGRRKERPTSLNVFPLADGTVRAQIGGKLVPAGDHWHLSDLGQ
LQSSSSYQCPQDEMSESGQSSAAATPSTTGTKSNTPTSSVPSAAVTPLNESLQPLGDYGV
GSKNSKRAREKRDSRNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDMCPETRLD
RTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSGMGKEVGNLLLE
NSQLLETKNALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKVKLENRIKELEEELKRV
KSEAIIARREPKEEAEDVSSYLCTESDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQ
EAVRWTEMIRASREHPSVQEKKKSTIWQFFSRLFSSSSSPPPAKRPYPSVNIHYKSPTTA
GFSQRRNHAMCPISAGSRPLEFFPDDDCTSSARREQKREQYRQVREHVRNDDGRLQACGW
SLPAKYKQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPTMKLWCAAGVNLSGWRPNEDDAG
NGVKPAPGRDPLTCDREGDGEPKSAHTSPEKKKAKELPEMDATSSRVWILTSTLTTSKVV
IIDANQPGTVVDQFTVCNAHVLCISSIPAASDSDYPPGEMFLDSDVNPEDPGADGVLAGI
TLVGCATRCNVPRSNCSSRGDTPVLDKGQGEVATIANGKVNPSQSTEEATEATEVPDPGP
SEPETATLRPGPLTEHVFTDPAPTPSSGPQPGSENGPEPDSSSTRPEPEPSGDPTGAGSS
AAPTMWLGAQNGWLYVHSAVANWKKCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHR
GEDGQWDLSNYHLMDLGHPHHSIRCMAVVYDRVWCGYKNKVHVIQPKTMQIEKSFDAHPR
RESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVR
ITALLVAGSRLWVGTGNGVVISIPLTETVVLHRGQLLGLRANKTSPTSGEGARPGGIIHV
YGDDSSDRAASSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLDSPAEGPG
PAAPASEVEGQKLRNVLVLSGGEGYIDFRIGDGEDDETEEGAGDMSQVKPVLSKAERSHI
IVWQVSYTPE
NT seq 3993 nt NT seq  +upstreamnt  +downstreamnt
atgatggagatccagatggacgagggcggcggcgtggtggtgtaccaggacgactactgc
tccggctcggtgatgtcggagcgggtgtcgggcctggcgggctccatctaccgcgagttc
gagcgcctcatccactgctacgacgaggaggtggtcaaggagctcatgccgctggtggtg
aacgtgctggagaacctagactcggtgctcagcgagaaccaggagcacgaggtggagctg
gagctgctgcgcgaggacaacgagcagctgctcacccagtacgagcgtgagaaggcgctg
cgcaggcaggcggaggagaaattcattgagtttgaagatgctctggaacaagagaagaaa
gagctgcaaatccaggtggagcactacgagttccagacgcgccagctggagctgaaggcc
aagaactatgccgatcagatttcccggttggaggagcgggagtcggagatgaagaaggag
tacaatgccctgcaccagcggcacacagagatgatacagacctacgtggagcacattgag
aggtccaagatgcagcaggtcggaggaaacagccagaccgagagcagcctgccggggcgg
aggaaggagcgccccacctccctgaacgtgttccccctggctgacggcacggtacgtgca
cagatcgggggcaagctcgtgcctgcgggggaccactggcacctgagtgacctcggccag
ctgcagtccagctccagctaccagtgtccacaggatgaaatgtccgagtcaggccagtcc
tcggcggccgccacacccagcaccacaggcaccaagtccaacacgcccacatcctccgtg
ccctcggccgccgtcacacccctcaacgagagcctgcagcccctgggggactatggcgtg
ggctccaagaacagcaagcgtgcccgggagaagcgcgacagccgcaacatggaagtacag
gtcacccaggagatgcgcaacgtcagtataggcatgggcagcagtgacgagtggtctgat
gttcaagacattattgactccacgccagagctggacatgtgtccagagacccgcctggac
cgcacaggaagcagcccaacccagggcatcgtgaacaaagctttcggcatcaacaccgac
tccctgtaccatgagctgtcgacggcagggtctgaggtcatcggggatgtggacgaaggg
gccgacctcctaggggagttctcaggaatgggcaaagaagtggggaatctgctactggaa
aactcacagcttctggaaaccaaaaacgccttgaatgtggtgaagaatgacctgattgcc
aaggtcgaccagctgtccggggagcaggaggtgctgaggggcgagttggaggctgctaag
caggccaaagtcaagctggaaaaccgtatcaaggagctggaagaggaactgaaaagagtg
aagtccgaggccatcatcgcccgccgtgaacccaaagaagaggcggaggatgtaagcagc
tatctctgtacagaatcggacaaaatccccatggcccagcgccgccgcttcacgcgggtg
gagatggcccgtgtgctcatggagcggaaccagtacaaggagcggctgatggagctgcag
gaggctgtgcggtggactgagatgatcagagcgtcccgagagcacccatccgtccaggag
aagaagaagtcgaccatctggcagttcttcagccgcctcttcagctcttcctccagcccc
cctccggccaagcgcccctatccctcggtgaacatccactacaagtcacccaccactgcc
ggcttcagccagcgccgcaaccatgccatgtgcccgatctcggcaggcagccggcccctg
gaattcttccctgacgacgactgcacgtcctccgcccgtcgagagcagaagcgcgagcag
taccgccaggtgcgtgagcacgtgcgtaacgacgacggccgtctgcaggcctgcggctgg
agcctgcccgccaagtacaagcagctgagtcccaacgggggccaggaggacacgcggatg
aagaacgtgccggtgccggtgtactgccgccctctggtggagaaggaccccaccatgaag
ctgtggtgtgccgcgggcgtcaacctgagcgggtggaggcccaatgaggacgacgctggg
aatggagtcaagccagcgccaggccgcgatcccctgacctgcgaccgcgaaggagacggc
gagcccaagagcgcccacacgtctcccgagaagaagaaggccaaggagctccctgaaatg
gacgccacctccagccgggtgtggatcctgaccagcaccctgaccaccagcaaggtggtg
atcatcgacgccaaccagccgggcacggtggtggaccagttcaccgtctgcaacgcgcac
gtgctgtgcatctccagcatccccgcggccagcgacagcgactaccctcccggggagatg
ttcctggacagcgacgtgaacccagaggacccgggcgcagatggcgtgctggccggtatc
accctggtgggctgtgccacccgctgcaacgtgccgcggagcaactgctcctcccgaggg
gacaccccagtgctagacaaggggcagggggaggtggccaccatcgccaacgggaaggtc
aacccgtcccagtccacagaggaggccacagaggccacggaggtgccagaccctgggccc
agcgagccagagacagccacattgcggcccgggcctctcacagagcacgtcttcactgac
ccagccccgaccccgtcctctggcccccagcctggcagcgagaacgggccagagcctgac
agcagcagcacacggccagagccagagcccagcggggaccccacgggagcaggcagcagt
gctgcacccaccatgtggctgggagcccagaacggctggctctatgtgcactcggctgtg
gccaactggaagaagtgcctgcactccatcaagctgaaggattctgtgctgagcctggtg
catgtcaaaggccgtgtgctggtggctctggcggacgggaccctggccatcttccaccgt
ggtgaagatggccagtgggatctgagcaactatcacctaatggacctgggccacccgcac
cactccatccgctgcatggctgttgtgtacgaccgcgtgtggtgtggctacaagaacaag
gtgcacgtcatccagcccaagaccatgcagatagagaagtcatttgacgcccacccgcgg
cgggagagccaggtgcggcagctggcgtggatcggcgatggcgtatgggtgtccatccgc
ctggactccaccctgaggctctaccatgcacacacgcaccagcatctacaggacgtggac
attgagccctacgtcagcaagatgctaggcactggcaagctgggtttctccttcgtacgc
atcacggccctgcttgtcgcgggcagccggctctgggtgggcaccggcaacggagtggtc
atctccatccccctgacagagactgtggtcctgcaccgaggccagctcctggggctccga
gccaataagacatcccccacctctggggagggcgcccgtcccgggggcatcatccacgtg
tatggcgatgacagcagtgacagggcggccagcagcttcatcccctactgctccatggcc
caggcccagctatgcttccatgggcaccgcgatgccgtgaagttctttgtctcggtgcca
gggaacgtgctggccaccctgaatgggagtgtgctggacagcccagccgagggccctggg
ccagctgcccctgcctcggaggtcgagggccagaagctgcggaacgtgctggtgctgagc
ggcggggagggctacatcgacttccgcattggagacggagaggacgacgagacggaggag
ggcgcaggggacatgagccaggtgaagcccgtgctgtccaaggcagagcgcagtcacatc
atcgtgtggcaggtgtcctacacccccgagtga

DBGET integrated database retrieval system