KEGG   Homo sapiens (human): 23165Help
Entry
23165             CDS       T01001                                 

Gene name
NUP205, C7orf14
Definition
nucleoporin 205kDa
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    23165 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q33
AA seq 2012 aa AA seqDB search
MATPLAVNSAASLWGPYKDIWHKVGNALWRRQPEAVHLLDKILKKHKPDFISLFKNPPKN
VQQHEKVQKASTEGVAIQGQQGTRLLPEQLIKEAFILSDLFDIGELAAVELLLAGEHQQP
HFPGLTRGLVAVLLYWDGKRCIANSLKALIQSRRGKTWTLELSPELASMTTRFTDELMEQ
GLTYKVLTLVSQIDVNNEFEKLQRERGLGSEKHRKEVSDLIKECRQSLAESLFAWACQSP
LGKEDTLLLIGHLERVTVEANGSLDAVNLALLMALLYCFDISFIEQSTEERDDMIHQLPL
LTEKQYIATIHSRLQDSQLWKLPGLQATVRLAWALALRGISQLPDVTALAEFTEADEAMA
ELAIADNVFLFLMESVVVSEYFYQEEFYIRRVHNLITDFLALMPMKVKQLRNRADEDARM
IHMSMQMGNEPPISLRRDLEHLMLLIGELYKKNPFHLELALEYWCPTEPLQTPTIMGSYL
GVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGLANGPQCAHYCFSLLKVNGSS
HVENIQGAGGSPVSWEHFFHSLMLYHEHLRKDLPSADSVQYRHLPSRGITQKEQDGLIAF
LQLTSTIITWSENARLALCEHPQWTPVVVILGLLQCSIPPVLKAELLKTLAAFGKSPEIA
ASLWQSLEYTQILQTVRIPSQRQAIGIEVELNEIESRCEEYPLTRAFCQLISTLVESSFP
SNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEVFYKLLRDYEPQL
EDFVDQFVELQGEEIIAYKPPGFSLMYHLLNESPMLELALSLLEEGVKQLDTYAPFPGKK
HLEKAVQHCLALLNLTLQKENLFMDLLRESQLALIVCPLEQLLQGINPRTKKADNVVNIA
RYLYHGNTNPELAFESAKILCCISCNSNIQIKLVGDFTHDQSISQKLMAGFVECLDCEDA
EEFVRLEEGSELEKKLVAIRHETRIHILNLLITSLECNPPNLALYLLGFELKKPVSTTNL
QDPGVLGCPRTCLHAILNILEKGTEGRTGPVAVRESPQLAELCYQVIYQLCACSDTSGPT
MRYLRTSQDFLFSQLQYLPFSNKEYEISMLNQMSWLMKTASIELRVTSLNRQRSHTQRLL
HLLLDDMPVKPYSDGEGGIEDENRSVSGFLHFDTATKVRRKILNILDSIDFSQEIPEPLQ
LDFFDRAQIEQVIANCEHKNLRGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEIS
TVLQYVVGRNKLLQCLHAKRHALESWRQLVEIILTACPQDLIQAEDRQLIIRDILQDVHD
KILDDEAAQELMPVVAGAVFTLTAHLSQAVLTEQKQTSVLGPAEAHYAFMLDSCFTSPPP
EENPLVGFASIGDSSLYIILKKLLDFILKTGGGFQRVRTHLYGSLLYYLQIAQRPDEPDT
LEAAKKTMWERLTAPEDVFSKLQRENIAIIESYGAALMEVVCRDACDGHEIGRMLALALL
DRIVSVDKQQQWLLYLSNSGYLKVLVDSLVEDDRTLQSLLTPQPPLLKALYTYESKMAFL
TRVAKIQQGALELLRSGVIVRLAQCQVYDMRPETDPQSMFGMRDPPMFIPTPVDRYRQIL
LPALQLCQVILTSSMAQHLQAAGQVLQFLISHSDTIQAILRCQDVSAGSLQELALLTGII
SKAALPGILSELDVDVNEGSLMELQGHIGRFQRQCLGLLSRFGGSDRLRQFKFQDDNVEG
DKVSKKDEIELAMQQICANVMEYCQSLMLQSSPTFQHAVCLFTPSLSETVNRDGPRQDTQ
APVVPYWRLPGLGIIIYLLKQSANDFFSYYDSHRQSVSKLQNVEQLPPDEIKELCQSVMP
AGVDKISTAQKYVLARRRLVKVINNRAKLLSLCSFIIETCLFILWRHLEYYLLHCMPTDS
QDSLFASRTLFKSRRLQDSFASETNLDFRSGLAIVSQHDLDQLQADAINAFGESLQKKLL
DIEGLYSKVRSRYSFIQALVRRIRGLLRISRN
NT seq 6039 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgcctttggcggtaaattcggctgctagtctatggggtccttacaaagacatt
tggcataaagtgggaaatgctctttggagaagacaacctgaagctgttcaccttcttgat
aagattttgaagaaacacaaacctgacttcatctcattgttcaaaaatccgccaaaaaat
gttcaacagcatgagaaggttcagaaagccagtacagagggagtcgccattcagggtcaa
cagggaactcgacttcttcctgaacagctcattaaagaagcctttattctcagtgacctt
tttgatattggagaattggcagctgttgagcttcttcttgctggagagcatcaacagcca
cattttcctggccttaccagaggattagtagctgttcttctgtactgggatggaaagcga
tgcattgcgaattccttgaaagccttgatacagtctagacggggaaagacatggacccta
gaactcagtccagagctggcttccatgacaacacgctttacagatgagctgatggagcaa
ggattgacttataaagttcttacgctggtgtcacagattgatgtgaataatgagtttgag
aaactacagcgagagagaggtttgggcagtgaaaaacatcgcaaagaggtttctgatctc
attaaggagtgcaggcagtctcttgcagaaagcctttttgcctgggcttgccagtcacct
ttaggcaaagaagacactctcctcctcattggacatttggaaagagtgacagttgaggct
aatggctcactggatgcagtgaatctggctcttcttatggcgcttctatactgttttgat
atcagttttatagagcaaagcacagaggaacgagatgatatgattcatcaacttccactg
ttgacagaaaaacagtacattgcaacaattcactctcgtcttcaggactcacagctttgg
aaactgcctgggctccaagccactgttagacttgcctgggcgctggcattgaggggaata
tcccagctacctgatgtgacagctctggcagaattcacagaggcagatgaagcaatggca
gaactcgcaattgctgacaacgttttcctgttcctcatggaatctgtagtggtatcagaa
tacttttatcaggaagaattttatattcgcagagtccataatctcatcacagatttcctt
gcacttatgccaatgaaggtgaaacagctgaggaatcgggcagatgaagatgctcgaatg
attcacatgagtatgcagatgggtaatgaaccccccatttcacttagaagggacctggaa
cacttaatgcttttgattggcgagctatataaaaagaacccttttcatctggagcttgct
ctagaatattggtgtcccacagagcctcttcagactccgactatcatgggctcttatcta
ggggtggctcatcagcggccccctcaacgccaggttgtcttgtcaaagtttgttaggcaa
atgggtgacctgttgcctccaactatttatattccttatttgaagatgctccagggattg
gccaatgggcctcagtgtgcccactactgtttcagcctgctcaaagtcaatggtagtagt
catgttgaaaatattcagggagcaggtggcagtcctgtttcctgggaacatttctttcac
tccttgatgctttaccacgaacaccttcggaaggatcttccaagtgcagatagtgtccag
taccgtcaccttccttcccgtggcatcacccagaaggagcaagatggattgattgctttt
ttgcagctcacgtctaccatcattacttggagtgaaaatgctcgcttggcactctgtgaa
caccctcagtggacccctgttgtggtgattctgggactcctccaatgcagtattccccct
gtcctaaaagctgagctactgaagacactcgcagcttttggaaaatctcctgaaattgct
gcttccctctggcagtcattggaatacactcagatactgcagaccgtgaggattccaagc
caaaggcaagctattggtattgaggttgaactaaatgaaatagaatcccggtgtgaagaa
tacccattgactcgggccttttgccagcttattagtactctggtggagagctcatttcct
tctaatttgggtgctggactgcggccccctggctttgacccttatttgcagttccttaga
gactctgtgtttctacgattccgtacaagagcttaccggagagcagctgaaaagtgggaa
gttgctgaggtggttttggaggtgttttataaattgctcagagattatgagcctcagctt
gaagattttgtagaccagtttgtggaactacaaggagaagaaatcatagcctataagcca
cctggatttagtctgatgtatcatctgctgaatgagtcaccaatgttggagcttgctctc
agtttactggaagaaggagttaagcagcttgacacctatgccccctttcctgggaaaaaa
cacctggagaaagcagtacagcattgccttgcacttctcaatcttactctgcaaaaggaa
aatctttttatggaccttctaagagagagtcaactggctctaatagtctgtcctttagaa
cagcttttgcagggaattaatcccagaactaagaaggcagataatgtggtaaacattgcc
agatacctatatcatggcaatactaatccagaattggcttttgaaagtgccaagatcctc
tgttgtatctcttgcaactctaatattcagataaagttggttggagatttcacacatgac
cagagtataagtcagaaactaatggctggatttgtggagtgtttggattgtgaagatgca
gaagaatttgtacgtctggaagagggatcagaacttgaaaagaaattagttgcaattcgt
catgaaacaagaatccacatcttgaatcttctcattacctctctggaatgcaatccaccc
aatcttgctctctacctgttgggctttgaattgaaaaaacctgtcagtactacaaaccta
caagatccaggagtgttaggttgccctcggacatgccttcacgccattctaaacatcttg
gagaaaggaacggaagggagaacaggcccagtggcggtgcgagaatctcctcagctggct
gagctatgttaccaggtcatatatcagttatgtgcatgctctgatacatctggtcctact
atgaggtacttgagaaccagccaggatttcttattttcccagttgcagtatctaccattt
tctaacaaagaatatgaaatatctatgctgaaccagatgtcatggcttatgaaaactgcc
tcaatagagctaagggtaacctctctgaatcgtcagcggtcacatacccagaggctccta
cacctcttactggatgacatgccagtgaaaccatactcagatggtgaaggaggaatagaa
gatgaaaacaggtctgtttctgggttccttcactttgacactgctacaaaagtacgtcga
aaaattctaaatattcttgactcgattgacttcagtcaggagatccctgagcctttgcag
ttggatttttttgatcgggcccagattgaacaagttattgctaactgtgaacacaagaat
ttacggggacagacagtctgcaatgtcaagcttcttcatagggttcttgtagctgaagta
aatgcccttcagggtatggcagccataggacagagacctctactaatggaggaaatcagc
actgtacttcagtatgtggtaggaagaaataaattgctgcagtgtcttcatgcaaaacgt
catgctctggagtcgtggaggcaactagtagaaattatactgacagcttgtccccaggac
ctcattcaggcagaggatcgacaactgattattcgtgatattttacaagatgtgcatgat
aagatactggatgatgaagctgcgcaagagttaatgcctgtggtcgccggggcagtgttc
acactgactgctcacctaagccaggccgtcctcactgaacagaagcaaacatcagtcttg
ggaccagcagaggcccattacgcttttatgcttgatagttgcttcacctcacctcctcct
gaagagaacccattagtgggttttgcttctattggagattcttcactttacatcatattg
aagaaactgttagacttcattttgaagacaggtggtggattccaacgagtgaggactcac
ttgtatggctctctgctttattacttacagattgcccagagacctgatgaaccagacacc
ttagaagcagccaagaaaaccatgtgggaaaggctgacagcccctgaagatgtatttagc
aaattacagcgagaaaacatagccattattgaaagttatggcgccgccctcatggaagtg
gtctgtcgagatgcttgtgatggtcatgagattggaaggatgctggccctggctctactt
gatagaattgtctccgtggataaacagcagcagtggcttttgtatctttctaacagtggc
tacttgaaggtcctcgtagacagcttggtagaagatgaccgtactttgcagagcttactc
accccacagcctccccttttaaaagcactttatacttatgaatctaaaatggcatttctc
acaagagtggcaaagatacagcagggtgcattagagctgctaagatcaggggtgattgtg
agactagctcaatgccaagtctatgacatgcgcccagaaacggacccgcagagcatgttt
ggcatgagagaccctccaatgttcatccctaccccagtggatcgctaccgccagattctc
ctcccagctctccagctgtgccaggtcatcctcacatctagtatggcccagcacttgcag
gcagcagggcaggtattgcagtttcttatttcacattctgataccatacaagcaattctg
cgctgtcaggatgttagtgctgggtctttgcaggaattggctctgctgacaggaattata
agtaaagcagcacttcctggaatattaagtgaacttgacgttgatgtaaatgaagggtct
ctaatggagctacagggacatattggaagattccagcgccagtgcttaggactactaagt
cgctttggtggctctgacagactgcgtcagtttaaatttcaagacgataatgtggaggga
gataaagtaagcaagaaagatgagattgaactggctatgcagcagatttgtgccaatgta
atggaatattgccagtcactcatgttacagagttcccctaccttccagcatgctgtgtgt
ctcttcactcctagcctttcagaaacagttaatagagatggaccgcggcaagatacccaa
gctccagtggttccatactggcgcctgcctggtttaggcattatcatctacctgctgaaa
cagagtgctaatgatttcttcagctattatgacagtcatcgacagagtgtcagcaagcta
caaaatgtagagcagcttcccccagatgagataaaagagttgtgtcagtctgtgatgcct
gctggtgttgataaaatctccactgctcagaaatatgttctagcaagacggcgcttggtg
aaggtgatcaacaatcgagctaaactgctttccctttgttcttttatcatagagacctgc
ctatttattctttggcgccatctggagtactacttgttacattgcatgcccacggattct
caagattccttatttgcctcgagaaccttgtttaaaagcagaagactgcaagattccttc
gcctcagaaaccaatctagattttagaagtgggctggctatagtgagccaacatgattta
gaccagcttcaggctgatgcaatcaacgcttttggagaatcactacaaaagaaacttctg
gacattgaaggattatattcaaaagttcgatctcgatatagtttcatacaggctcttgtc
agacgtatccgtggcctcttgaggatatcaaggaactga

DBGET integrated database retrieval system