KEGG   Homo sapiens (human): 23171Help
Entry
23171             CDS       T01001                                 

Gene name
GPD1L, GPD1-L
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase 1-like
  KO
K00006  
glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Disease
H00728  
Brugada syndrome (BRS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    23171 (GPD1L)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.8  glycerol-3-phosphate dehydrogenase (NAD+)
     23171 (GPD1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q8N335(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
3p22.3
AA seq 351 aa AA seqDB search
MAAAPLKVCIVGSGNWGSAVAKIIGNNVKKLQKFASTVKMWVFEETVNGRKLTDIINNDH
ENVKYLPGHKLPENVVAMSNLSEAVQDADLLVFVIPHQFIHRICDEITGRVPKKALGITL
IKGIDEGPEGLKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKVMENGLLFK
ELLQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVIRLGLMEMIAF
ARIFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFARTGKTIEELEKEMLNGQKLQ
GPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPVQEMLSCLQSHPEHT
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggcgcccctgaaagtgtgcatcgtgggctcggggaactggggttcagctgtt
gcaaaaataattggtaataatgtcaagaaacttcagaaatttgcctccacagtcaagatg
tgggtctttgaagaaacagtgaatggcagaaaactgacagacatcataaataatgaccat
gaaaatgtaaaatatcttcctggacacaagctgccagaaaatgtggttgccatgtcaaat
cttagcgaggctgtgcaggatgcagacctgctggtgtttgtcattccccaccagttcatt
cacagaatctgtgatgagatcactgggagagtgcccaagaaagcgctgggaatcaccctc
atcaagggcatagacgagggccccgaggggctgaagctcatttctgacatcatccgtgag
aagatgggtattgacatcagtgtgctgatgggagccaacattgccaatgaggtggctgca
gagaagttctgtgagaccaccatcggcagcaaagtaatggagaacggccttctcttcaaa
gaacttctgcagactccaaattttcgaattaccgtggttgatgatgcagacactgttgaa
ctctgtggtgcgcttaagaacatcgtagctgtgggagctgggttctgcgacggcctccgc
tgtggagacaacaccaaagcggccgtcatccgcctgggactcatggaaatgattgctttt
gccaggatcttctgcaaaggccaagtgtctacagccaccttcctagagagctgcggggtg
gccgacctgatcaccacctgttacggagggcggaaccgcagggtggccgaggccttcgcc
agaactgggaagaccattgaagagttggagaaggagatgctgaatgggcaaaagctccaa
ggaccgcagacttctgctgaagtgtaccgcatcctcaaacagaagggactactggacaag
tttccattgtttactgcagtgtatcagatctgctacgaaagcagaccagttcaagagatg
ttgtcttgtcttcagagccatccagagcatacataa

DBGET integrated database retrieval system