KEGG   Homo sapiens (human): 23175Help
Entry
23175             CDS       T01001                                 

Gene name
LPIN1, PAP1
Definition
(RefSeq) lipin 1
  KO
K15728  
phosphatidate phosphatase LPIN [EC:3.1.3.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
mTOR signaling pathway
Disease
H01290  
Acute recurrent myoglobinuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    23175 (LPIN1)
   00564 Glycerophospholipid metabolism
    23175 (LPIN1)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    23175 (LPIN1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     23175 (LPIN1)
Protein phosphatases and associated proteins [BR:hsa01009]
 HAD phosphatases
  Other HAD phosphatases
   23175 (LPIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q14693(Tbio)
UniProt: 
Position
2p25.1
AA seq 890 aa AA seqDB search
MNYVGQLAGQVFVTVKELYKGLNPATLSGCIDIIVIRQPNGNLQCSPFHVRFGKMGVLRS
REKVVDIEINGESVDLHMKLGDNGEAFFVQETDNDQEVIPMHLATSPILSEGASRMECQL
KRGSVDRMRGLDPSTPAQVIAPSETPSSSSVVKKRRKRRRKSQLDSLKRDDNMNTSEDED
MFPIEMSSDEAMELLESSRTLPNDIPPFQDDIPEENLSLAVIYPQSASYPNSDREWSPTP
SPSGSRPSTPKSDSELVSKSTERTGQKNPEMLWLWGELPQAAKSSSPHKMKESSPLSSRK
ICDKSHFQAIHSESSDTFSDQSPTLVGGALLDQNKPQTEMQFVNEEDLETLGAAAPLLPM
IEELKPPSASVVQTANKTDSPSRKRDKRSRHLGADGVYLDDLTDMDPEVAALYFPKNGDP
SGLAKHASDNGARSANQSPQSVGSSGVDSGVESTSDGLRDLPSIAISLCGGLSDHREITK
DAFLEQAVSYQQFVDNPAIIDDPNLVVKIGSKYYNWTTAAPLLLAMQAFQKPLPKATVES
IMRDKMPKKGGRWWFSWRGRNTTIKEESKPEQCLAGKAHSTGEQPPQLSLATRVKHESSS
SDEERAAAKPSNAGHLPLLPNVSYKKTLRLTSEQLKSLKLKNGPNDVVFSVTTQYQGTCR
CEGTIYLWNWDDKVIISDIDGTITRSDTLGHILPTLGKDWTHQGIAKLYHKVSQNGYKFL
YCSARAIGMADMTRGYLHWVNERGTVLPQGPLLLSPSSLFSALHREVIEKKPEKFKVQCL
TDIKNLFFPNTEPFYAAFGNRPADVYSYKQVGVSLNRIFTVNPKGELVQEHAKTNISSYV
RLCEVVDHVFPLLKRSHSSDFPCSDTFSNFTFWREPLPPFENQDIHSASA
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgtggggcagttagccggccaggtgtttgtcaccgtgaaggagctctacaag
gggctgaatcccgccacactctcagggtgcattgacatcattgtcatccgccagcccaat
ggaaacctccaatgctcccctttccacgtccgctttgggaagatgggggtcctgcgctcc
cgagagaaagtggttgacatagaaatcaatggggaatctgtggatttgcatatgaaattg
ggagataatggagaagcattttttgttcaagaaacagataatgatcaggaagttatccct
atgcacctggccacctcccccatcctgtcagaaggagcttcgagaatggaatgccagctg
aaaaggggctctgtggacaggatgagaggcctggaccccagcacgccagcccaagtgatc
gctcccagcgagacgccgtcaagcagctctgtagtaaagaagagaagaaaaaggaggaga
aagtcacagctggacagcctgaagagagatgacaacatgaacacatctgaggatgaggac
atgttccccatcgagatgagctcggatgaggccatggagctgctggagagcagcagaact
cttcctaatgatatacctccattccaagatgatattcctgaggaaaacctctccctggct
gtgatttaccctcagtcagcctcataccctaattcggatagagagtggtcacccactccc
agtccttccggttcccgaccttcaacacctaaaagtgattcagaattggtcagcaagtcc
acggaaaggacagggcagaagaacccagaaatgctttggctgtggggagagctgccgcag
gctgctaagtcttcttctccacacaagatgaaagagtccagcccattgagcagtagaaaa
atttgtgataaaagtcactttcaggccattcacagcgaatcttcagacacttttagtgac
caatcgccaactctggtcggtggggcacttttggaccagaacaagcctcagacagaaatg
cagtttgtgaatgaagaagacctggagaccttaggagcagcagcgccactcttgcccatg
atcgaggagctcaaacccccctctgccagtgtagtccagacagcaaacaagacggattct
ccttccaggaaaagagataaacgaagccgacatcttggtgctgacggcgtctacttggat
gacctcacagacatggatcctgaagtggcggccctgtattttcccaaaaacggagatcct
tccggactcgcaaaacatgcaagcgacaacggagcccggtcagccaaccagtccccgcag
tcggtgggcagctcgggcgtggacagtggcgtggagagcacctcggacgggctgagggac
ctcccttccatcgccatctccctctgcgggggcctcagcgaccaccgggagatcacgaaa
gatgcattcctggagcaagctgtgtcatatcaacagtttgtggacaaccccgctattatc
gatgaccccaatctcgtggtaaagattgggagtaaatattataactggacaacagcagca
cccctcctcctggcaatgcaggccttccagaaacctttgccaaaggccactgtggaatct
atcatgagggataaaatgcccaaaaagggaggaagatggtggttttcatggaggggaaga
aacaccacaatcaaggaggaaagtaagccagagcagtgcttggctggcaaggcccatagc
accggagagcaaccgccgcagctcagcttggccaccagggtaaagcatgaatcatcctcc
agtgatgaggagcgcgcagctgccaagccatcaaacgcaggccacctccctcttctgcct
aatgtcagctacaagaagactctccggctgacttccgagcagcttaaaagcttgaagttg
aagaatggccccaacgacgtggttttcagtgtcaccacgcagtaccaaggcacgtgccgc
tgtgagggcaccatctatctgtggaactgggatgataaagtcatcatttctgatattgat
gggacaattaccagatcagatactcttggccacattttgcccacccttgggaaggattgg
acccatcagggcatcgctaagctgtaccataaagtgagccagaatggatataaatttctc
tactgttctgcccgtgccatcgggatggcggacatgacgcggggctacctgcactgggtc
aacgagaggggcacggtgctgccccaggggcccctgctgctgagtcccagcagcctcttc
tctgccctgcacagagaagtgattgaaaagaagccagaaaagtttaaagtccagtgtttg
acagacatcaaaaacctgtttttccccaacacagaacccttttatgctgcttttggaaac
cgaccagctgatgtgtattcatacaagcaagtaggagtgtctttgaatagaatatttacc
gtcaaccctaaaggagagctggtacaggaacatgcaaagaccaacatctcttcgtatgtg
agactctgtgaagtagtcgaccacgttttcccgttgctgaaaagaagccattcttcagac
tttccctgttcggataccttcagtaacttcaccttttggagagagccactgccacctttt
gaaaaccaggacattcattctgcctcagcgtaa

DBGET integrated database retrieval system