KEGG   Homo sapiens (human): 23178Help
Entry
23178             CDS       T01001                                 

Gene name
PASK, PASKIN, STK37
Definition
(RefSeq) PAS domain containing serine/threonine kinase
  KO
K08801  
PAS domain containing serine/threonine kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     23178 (PASK)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   23178 (PASK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q37.3
AA seq 1323 aa AA seqDB search
MEDGGLTAFEEDQRCLSQSLPLPVSAEGPAAQTTAEPSRSFSSAHRHLSRRNGLSRLCQS
RTALSEDRWSSYCLSSLAAQNICTSKLHCPAAPEHTDPSEPRGSVSCCSLLRGLSSGWSS
PLLPAPVCNPNKAIFTVDAKTTEILVANDKACGLLGYSSQDLIGQKLTQFFLRSDSDVVE
ALSEEHMEADGHAAVVFGTVVDIISRSGEKIPVSVWMKRMRQERRLCCVVVLEPVERVST
WVAFQSDGTVTSCDSLFAHLHGYVSGEDVAGQHITDLIPSVQLPPSGQHIPKNLKIQRSV
GRARDGTTFPLSLKLKSQPSSEEATTGEAAPVSGYRASVWVFCTISGLITLLPDGTIHGI
NHSFALTLFGYGKTELLGKNITFLIPGFYSYMDLAYNSSLQLPDLASCLDVGNESGCGER
TLDPWQGQDPAEGGQDPRINVVLAGGHVVPRDEIRKLMESQDIFTGTQTELIAGGQLLSC
LSPQPAPGVDNVPEGSLPVHGEQALPKDQQITALGREEPVAIESPGQDLLGESRSEPVDV
KPFASCEDSEAPVPAEDGGSDAGMCGLCQKAQLERMGVSGPSGSDLWAGAAVAKPQAKGQ
LAGGSLLMHCPCYGSEWGLWWRSQDLAPSPSGMAGLSFGTPTLDEPWLGVENDREELQTC
LIKEQLSQLSLAGALDVPHAELVPTECQAVTAPVSSCDLGGRDLCGGCTGSSSACYALAT
DLPGGLEAVEAQEVDVNSFSWNLKELFFSDQTDQTSSNCSCATSELRETPSSLAVGSDPD
VGSLQEQGSCVLDDRELLLLTGTCVDLGQGRRFRESCVGHDPTEPLEVCLVSSEHYAASD
RESPGHVPSTLDAGPEDTCPSAEEPRLNVQVTSTPVIVMRGAAGLQREIQEGAYSGSCYH
RDGLRLSIQFEVRRVELQGPTPLFCCWLVKDLLHSQRDSAARTRLFLASLPGSTHSTAAE
LTGPSLVEVLRARPWFEEPPKAVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKE
KNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLV
MEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDF
TIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEE
NPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADY
TWEEVFRVNKPESGVLSAASLEMGNRSLSDVAQAQELCGGPVPGEAPNGQGCLHPGDPRL
LTS
NT seq 3972 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgggggcttaacagcctttgaagaggaccagagatgcctttcccagagcctc
cccttgccagtgtcagcagagggcccagctgcacagaccactgctgagcccagcaggtcg
ttttcctcagcccacagacacctgagcagaaggaatgggctttccagactctgccagagc
aggacagcgctctctgaagacagatggagctcctattgtctatcatcactggctgcccag
aatatttgtacaagtaaactgcactgccctgctgcccctgagcacacggacccgtccgaa
ccgcggggcagtgtgtcctgctgctccctgctgcggggactgtcctcagggtggtcctca
cctctgcttccggcccctgtgtgcaaccctaacaaggccatcttcacggtggatgccaag
accacagagatcctggttgctaacgacaaagcttgcgggctcctggggtacagcagccag
gacctgattggccagaagctcacgcagttctttctgaggtcagattctgatgtggtggag
gccctcagcgaggagcacatggaggccgacggccacgctgcggtggtgtttggcacggtg
gtggacatcatcagccgtagtggggagaagattccagtgtctgtgtggatgaagaggatg
cggcaggagcgccgcctatgctgcgtggtggtcctggagcccgtggagagggtctcgacc
tgggtcgctttccagagcgatggcaccgtcacgtcatgtgacagtctctttgctcatctt
cacgggtacgtgtctggggaggacgtggctgggcagcatatcacagacctgatcccttct
gtgcagctccctccttctggccagcacatcccaaagaatctcaagattcagaggtctgtt
ggaagagccagggacggtaccaccttccctctgagcttaaagctgaaatcccaacccagc
agcgaggaggcgaccaccggtgaggcggcccctgtgagcggctaccgggcatctgtctgg
gtgttctgcaccatcagtggcctcatcaccctcctgccggatgggaccatccacggcatc
aaccacagcttcgcgctgacactgtttggttacggaaagacggagctcctgggcaagaat
atcactttcctgattcctggtttctacagctacatggaccttgcgtacaacagctcatta
cagctcccagacctggccagctgcctggacgtcggcaatgagagtgggtgtggggagaga
accttggacccgtggcagggccaggacccagctgaggggggccaggatccaaggattaat
gtcgtgcttgctggtggccacgttgtgccccgagatgagatccggaagctgatggaaagc
caagacatcttcaccgggactcagactgagctgattgctggaggccagctcctttcctgc
ctctcacctcagcctgctccaggggtggacaatgtcccagaaggaagcctgccagtgcac
ggtgaacaggcgctgcccaaggaccagcaaatcactgccttggggagagaggaacctgtg
gcaatagagagccccggacaggatcttctgggagaaagcaggtctgaaccagtggatgtg
aagccatttgcttcctgcgaagattctgaagctccagtcccagctgaggatgggggcagt
gatgctggcatgtgtggcctgtgtcagaaggcccagctagagcggatgggagtcagtggt
cccagcggttcagacctttgggctggggctgccgtggccaagccccaggccaagggtcag
ctggcggggggcagcctcctgatgcactgcccttgctatgggagtgaatggggcttgtgg
tggcgaagccaggacttggcccccagcccctctgggatggcaggcctctcgtttgggaca
cctactctagatgagccgtggctgggagtggaaaacgaccgagaagagctgcagacctgc
ttgattaaggagcagctgtcccagttgagccttgcaggagccctggatgtcccccacgcc
gaactcgttccgacagagtgccaggctgtcaccgctcctgtgtcgtcctgcgatctggga
ggcagagacctgtgcggtggctgcacgggcagctcctcagcctgctatgccttggccacg
gacctccctgggggcctggaagcagtggaggcccaggaggttgatgtgaattcgttttcc
tggaacctcaaggaactctttttcagtgaccagacagaccaaacgtcatcaaattgttcc
tgtgctacgtctgaactcagagagacaccctcttccttggcagtgggctccgatccagat
gtaggcagtctccaggaacaggggtcgtgtgtcctggatgacagggagctgttactactg
accggcacctgtgttgaccttggccaaggccgacggttccgggagagctgtgtgggacat
gatccaacagaaccgcttgaggtttgtttggtgtcctctgagcattatgcagcaagcgac
agagaaagcccaggacacgttccttccacgttggatgctggccctgaggacacgtgccca
tcagcagaggagccaaggctgaacgtccaggtcacctccacgcccgtgatcgtgatgcgc
ggggctgctggcctgcagcgggagatccaggagggtgcctactccgggagctgctaccat
cgagatggcttacggctgagtatacagtttgaggtgaggcgggtggagctccagggcccc
acacctctgttctgctgctggctggtgaaagacctcctccacagccaacgcgactcagcc
gccaggacccgcctgttccttgccagcctgcccggctccacccactctaccgctgctgag
ctcaccggacccagcctggtggaagtgctcagagccagaccctggtttgaggagcccccc
aaggctgtggaactggaggggttggcggcctgtgagggcgagtactcccaaaagtacagt
accatgagcccgctgggcagtggggccttcggcttcgtgtggactgctgtggacaaggaa
aaaaacaaggaggtggtggtgaagtttattaagaaggagaaggtcttggaggattgttgg
attgaggatcccaaacttgggaaagttactttagagatcgcaattctatccagggtggag
cacgccaatatcatcaaggtattggatatatttgaaaaccaagggttcttccagcttgtg
atggagaagcacggctccggcctagacctcttcgctttcatcgaccgccaccccaggctg
gatgagcccctggcgagctacatcttccgacaactagtgtcagcagtgggatacctgcgc
ttgaaggacatcatccaccgtgacatcaaggatgagaacatcgtgatcgccgaggacttc
acaatcaagctgatagactttggctcggccgcctacttggaaaggggaaaattattttat
actttttgtgggaccatcgagtactgtgcaccggaagttctcatggggaatccctacaga
gggccggagctggagatgtggtctctgggagtcactctgtacacgctggtctttgaggag
aaccccttctgtgagctggaggagaccgtggaggctgccatacacccgccatacctggtg
tccaaagaactcatgagccttgtgtctgggctgctgcagccagtccctgagagacgcacc
accttggagaagctggtgacagacccgtgggtaacacagcctgtgaatcttgctgactat
acatgggaagaggtgtttcgagtaaacaagccagaaagtggagttctgtccgctgcgagc
ctggagatggggaacaggagcctgagtgatgtggcccaggctcaggagctttgtgggggc
cccgttccaggcgaggctcctaatggccaaggctgtttgcatcccggggatccccgtctg
ctgaccagctaa

DBGET integrated database retrieval system