KEGG   Homo sapiens (human): 23186Help
Entry
23186             CDS       T01001                                 

Gene name
RCOR1, COREST, RCOR
Definition
REST corepressor 1
Orthology
K11829  
REST corepressor 1
Organism
hsa  Homo sapiens (human)
Pathway
Huntington's disease
Class
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q32.31
AA seq 485 aa AA seqDB search
MPAMVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAAS
AAAAPNNGQNKSLAAAAPNGNSSSNSWEEGSSGSSSDEEHGGGGMRVGPQYQAVVPDFDP
AKLARRSQERDNLGMLVWSPNQNLSEAKLDEYIAIAKEKHGYNMEQALGMLFWHKHNIEK
SLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKKTR
TKTSVMDRHARKQKREREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEK
HSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNS
ALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQV
KNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVR
YASAS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgccggccatggtggagaagggccccgaggtctcagggaagcggagagggaggaacaac
gcggccgcctccgcctccgccgccgccgcctccgccgccgcctcggccgcctgcgcctcg
ccagccgccactgccgcctcgggcgccgccgcctcctcagcctcggccgccgccgcctca
gccgccgccgcccccaataatggccagaataaaagtttggcggcggcggcgcccaatggc
aacagcagcagcaactcctgggaggaaggcagctcgggctcgtccagcgacgaggagcac
ggtggcggtggcatgagggtcggaccccagtaccaggcggtggtgcccgacttcgacccc
gccaaactggcaagacgcagtcaagaacgggacaatcttggcatgttggtctggtcaccc
aatcaaaatctgtcagaagcaaagttggatgaatacattgccattgccaaagaaaagcat
gggtacaacatggaacaggctcttgggatgctcttctggcataaacataatatcgaaaag
tcattggctgatttgcccaactttacccctttcccagatgagtggactgtggaagataaa
gtcttatttgagcaagcctttagttttcatgggaaaacttttcatagaatccaacaaatg
cttccagataaatctatagcaagtctggtgaaattttactattcttggaagaagacgagg
actaaaactagtgtgatggatcgccatgcccggaaacaaaaacgggagcgggaggagagc
gaggatgaactggaagaggcaaatggaaacaatcccattgacattgaggttgatcaaaac
aaggaaagcaaaaaggaggttccccctactgagacagttcctcaggtcaaaaaagaaaaa
catagcacacaagctaaaaatagagcaaaaaggaaacctccaaaaggaatgtttctttct
caagaagatgtggaggctgtttctgccaatgccactgctgctaccacggtgctgagacaa
ctagacatggaattggtttcagtcaaacgacagatccagaatattaaacagacaaacagt
gctctcaaagaaaaacttgatggtggaatagaaccatatcgacttccagaggtcattcag
aaatgtaatgcacgttggactacagaagagcagcttctcgccgtacaagccatcaggaaa
tatggccgagattttcaggcaatctcagacgtgattgggaacaaatcagtggtacaagtg
aaaaacttttttgtaaattatcgacgccgcttcaacatagatgaagttttacaagaatgg
gaggcagaacatggtaaagaagagaccaatgggcccagtaaccagaagcctgtgaagtcc
ccagataattccattaagatgcccgaagaggaagacgaggctcctgttctggatgtcaga
tatgcatctgcctcctga

DBGET integrated database retrieval system