KEGG   Homo sapiens (human): 23186Help
Entry
23186             CDS       T01001                                 

Gene name
RCOR1, COREST, RCOR
Definition
(RefSeq) REST corepressor 1
  KO
K11829  REST corepressor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    23186 (RCOR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_DNA-binding ELM2 Myb_DNA-bind_7 Myb_DNA-bind_6 Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 23186
NCBI-ProteinID: NP_055971
OMIM: 607675
HGNC: 17441
Ensembl: ENSG00000089902
Vega: OTTHUMG00000171778
Pharos: Q9UKL0(Tbio)
UniProt: Q9UKL0
Structure
PDB: 

Jmol
Position
14q32.31-q32.32
AA seq 485 aa AA seqDB search
MPAMVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAAS
AAAAPNNGQNKSLAAAAPNGNSSSNSWEEGSSGSSSDEEHGGGGMRVGPQYQAVVPDFDP
AKLARRSQERDNLGMLVWSPNQNLSEAKLDEYIAIAKEKHGYNMEQALGMLFWHKHNIEK
SLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKKTR
TKTSVMDRHARKQKREREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEK
HSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNS
ALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQV
KNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVR
YASAS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgccggccatggtggagaagggccccgaggtctcagggaagcggagagggaggaacaac
gcggccgcctccgcctccgccgccgccgcctccgccgccgcctcggccgcctgcgcctcg
ccagccgccactgccgcctcgggcgccgccgcctcctcagcctcggccgccgccgcctca
gccgccgccgcccccaataatggccagaataaaagtttggcggcggcggcgcccaatggc
aacagcagcagcaactcctgggaggaaggcagctcgggctcgtccagcgacgaggagcac
ggtggcggtggcatgagggtcggaccccagtaccaggcggtggtgcccgacttcgacccc
gccaaactggcaagacgcagtcaagaacgggacaatcttggcatgttggtctggtcaccc
aatcaaaatctgtcagaagcaaagttggatgaatacattgccattgccaaagaaaagcat
gggtacaacatggaacaggctcttgggatgctcttctggcataaacataatatcgaaaag
tcattggctgatttgcccaactttacccctttcccagatgagtggactgtggaagataaa
gtcttatttgagcaagcctttagttttcatgggaaaacttttcatagaatccaacaaatg
cttccagataaatctatagcaagtctggtgaaattttactattcttggaagaagacgagg
actaaaactagtgtgatggatcgccatgcccggaaacaaaaacgggagcgggaggagagc
gaggatgaactggaagaggcaaatggaaacaatcccattgacattgaggttgatcaaaac
aaggaaagcaaaaaggaggttccccctactgagacagttcctcaggtcaaaaaagaaaaa
catagcacacaagctaaaaatagagcaaaaaggaaacctccaaaaggaatgtttctttct
caagaagatgtggaggctgtttctgccaatgccactgctgctaccacggtgctgagacaa
ctagacatggaattggtttcagtcaaacgacagatccagaatattaaacagacaaacagt
gctctcaaagaaaaacttgatggtggaatagaaccatatcgacttccagaggtcattcag
aaatgtaatgcacgttggactacagaagagcagcttctcgccgtacaagccatcaggaaa
tatggccgagattttcaggcaatctcagacgtgattgggaacaaatcagtggtacaagtg
aaaaacttttttgtaaattatcgacgccgcttcaacatagatgaagttttacaagaatgg
gaggcagaacatggtaaagaagagaccaatgggcccagtaaccagaagcctgtgaagtcc
ccagataattccattaagatgcccgaagaggaagacgaggctcctgttctggatgtcaga
tatgcatctgcctcctga

DBGET integrated database retrieval system