KEGG   Homo sapiens (human): 2319Help
Entry
2319              CDS       T01001                                 

Gene name
FLOT2, ECS-1, ECS1, ESA, ESA1, M17S1
Definition
flotillin 2
Orthology
K07192  
flotillin
Organism
hsa  Homo sapiens (human)
Pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    2319 (FLOT2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   2319 (FLOT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q11-q12
AA seq 428 aa AA seqDB search
MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVE
TAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTV
EQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDAD
IGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLA
YELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQI
AEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALV
LEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLI
KKATGVQV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgggcaattgccacacggtggggcccaacgaggcgctggtggtttcagggggctgttgt
ggttccgactataaacagtacgtgtttggcggctgggcctgggcctggtggtgtatctcc
gacactcagaggatttccctagagattatgacgttgcagccccgctgcgaggacgtagag
acggccgagggggtagctttaactgtgacgggtgtcgcccaggtgaagatcatgacggag
aaggaactcctggccgtggcttgtgagcagtttctgggtaagaatgtgcaggacatcaaa
aacgtcgtcctgcagaccctggagggacatctgcgctccatcctcgggaccctgacagtg
gagcagatttatcaggaccgggaccagtttgccaagctggtgcgggaggtggcagcccct
gatgttggccgcatgggcattgagatcctcagcttcaccatcaaggacgtgtatgacaaa
gtggactatctgagctccctgggcaagacgcagactgccgtggtgcagagagatgctgac
attggcgtggccgaggctgaacgggacgcaggcatccgggaagctgagtgcaagaaggag
atgctggatgtgaagttcatggcagacaccaagattgctgactctaagcgagccttcgag
ctgcaaaagtcagccttcagtgaggaggttaacatcaagacagctgaggcccagttggcc
tatgagctgcagggggcccgtgaacagcagaagatccggcaggaagagattgagattgag
gttgtgcagcgcaagaaacagattgccgtggaggcacaggagatcctgcgtacggacaag
gagctcatcgctacagtgcgccggcctgccgaggccgaggcccaccgcatccagcagatt
gccgagggtgaaaaggtgaagcaggtcctcttggcacaggcagaggctgagaagatccgc
aaaatcggggaggcggaagcggcagtcatcgaggcgatgggcaaggcagaggctgagcgg
atgaagctcaaggcagaagcctaccagaaatacggggatgcagccaagatggccttggtg
ctagaggccctgccccagattgctgccaaaatcgctgccccacttaccaaggtcgatgag
attgtggtcctcagtggagacaacagtaaggtcacatcagaagtgaaccgactgctggcc
gagctgcctgcctctgtgcatgccctcacaggcgtggacctgtctaagatacccctgatc
aagaaggccactggtgtgcaggtgtga

DBGET integrated database retrieval system