KEGG   Homo sapiens (human): 23191Help
Entry
23191             CDS       T01001                                 

Gene name
CYFIP1, P140SRA-1, SHYC, SRA-1, SRA1
Definition
(RefSeq) cytoplasmic FMR1 interacting protein 1
  KO
K05749  
cytoplasmic FMR1 interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    23191 (CYFIP1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    23191 (CYFIP1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     23191 (CYFIP1)
   Factors involved in mRNA localization
    Other mRNA localization factors
     23191 (CYFIP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q11
AA seq 822 aa AA seqDB search
MAESLGSAELLRQLKSLGMERLLHAVNTFLRQSCTYLPLLTFGGKTSFVSLDVYGTEANC
SATSCSFPKAAATWPRRQAPGPLGELVRGPPDQGVAEQSFSHGLFEFGITNVPCIFSPPQ
MFPWIIQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESFFYTHLINFSET
LQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASMMEYVLYSLDLY
NDSAHYALTRFNKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVMAGSLLLDKRLRSEC
KNQGATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSLELAIGRFESED
LTSIVELDGLLEINRMTHKLLSRYLTLDGFDAMFREANHNVSAPYGRITLHVFWELNYDF
LPNYCYNGSTNRFVRTVLPFSQEFQRDKQPNAQPQYLHGSKALNLAYSSIYGSYRNFVGP
PHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRHEYGSPG
ILEFFHHQLKDIVEYAELKTVCFQNLREVGNAILFCLLIEQSLSLEEVCDLLHAAPFQNI
LPRVHVKEGERLDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLS
MFEVILTRIRSFLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCIPVGTHEFTVEQ
CFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVPLKKMVERIRKF
QILNDEIITILDKYLKSGDGEGTPVEHVRCFQPPIHQSLASS
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtccttgggctctgccgagctgctcaggcagctcaagtctctgggcatggag
aggctcttgcatgcggttaacacgtttctgaggcagtcgtgcacctacctacccctttta
acctttggtggtaagacatcatttgtttctcttgacgtttatggcacggaggcgaactgc
tccgctacaagttgttctttccccaaagcagcagcaacgtggccgcgtagacaggcaccc
ggacccctcggggagctggtgcggggccctcccgaccagggcgtagcggagcagtccttc
tctcatgggctttttgagtttggcataactaatgtaccatgtatattttctcccccacaa
atgtttccttggataatccagctttacatggtgagaaccatgctagagtccctcattgca
gacaaaagtggttccaagaaaaccttgagaagtagccttgaggggcccaccatattggac
atagaaaaatttcatcgagagtcattcttctacactcacttgataaatttcagtgaaacg
ctgcagcagtgctgtgacctttcgcagctgtggttccgagagttcttcctggagctgacc
atgggcaggaggatccagttccccattgagatgtcgatgccctggatcctgacggaccac
atcctggagaccaaggaggcatcgatgatggagtacgtgctctactccctggacctgtac
aatgacagcgcccactacgcgctcaccaggttcaacaagcagttcctgtacgacgaaatt
gaggccgaggtgaatctatgttttgaccaatttgtttacaagctagcagaccagatattt
gcctattataaggttatggcaggaagtttgcttcttgataaacggttacgatcagaatgc
aagaatcagggagccacgatccacctcccgccgtctaaccgctacgagacgctgctgaag
cagaggcatgtgcagctcctcggcagatcaatagacctcaatcgtctgatcacccagcgc
gtctcagcagccatgtataagtccctagaactggcgattggacgatttgaaagtgaagat
ttgacctccatagttgagctggatggcctgttggaaatcaaccgcatgacccacaagctg
ctgagccggtacctgacgctggacggcttcgacgccatgttccgggaggccaaccacaac
gtgtcagcgccctacgggaggatcaccctgcacgtcttctgggagctcaactatgacttc
ctgcccaactactgctacaacggctctaccaaccggtttgttcggacagtgttaccattt
tctcaggaatttcaaagagataagcagcctaatgcacagcctcagtatctgcatggatcc
aaggctttgaacttggcctactccagcatttacggcagctaccggaacttcgtgggacct
ccacactttcaagtcatctgccggcttctcggctaccagggtatcgccgtggtcatggag
gagctgctgaaggtcgtcaagagcctgctgcaaggcacaatcctgcagtacgtgaagacg
ctgatggaggtgatgcccaagatctgccgcctgccccggcacgagtacggctctcctggt
atcctggagttcttccaccaccagctgaaggacatcgtggagtacgcagagctgaagacg
gtgtgcttccagaacctgcgggaggtggggaacgccatcctcttctgcctgctcatcgag
cagagcctgtctttagaagaagtgtgtgacctgctgcacgcggctcctttccagaacatc
ttgccgcgagtccatgtgaaagagggggagagacttgatgccaaaatgaaaagactagaa
tcaaagtacgccccgctgcatcttgtcccactgattgaaagactggggacccctcagcaa
attgccatcgcaagagagggggacctgctgacaaaggagcgcctctgctgcggcctgtcc
atgtttgaggtcatcctgacacggatccggagctttctggatgaccccatctggcgcggg
cctctgcccagcaatggggtcatgcatgtggacgagtgtgtggagtttcacagactgtgg
agtgccatgcagtttgtctactgcattcccgtggggacacacgagttcacagtcgagcag
tgctttggtgatgggctacactgggctggctgtatgatcatcgtacttcttgggcagcag
cggcgttttgctgtgctggatttctgctaccatctacttaaagtccagaaacatgatggc
aaagatgagattattaaaaatgtgcctttgaagaagatggtggagagaattcgcaagttc
cagattctcaatgatgagatcatcaccatcctggataagtacctgaagtcaggcgacggg
gagggcacgccagtggagcatgtgcgctgcttccagccgcccatccaccagtccctcgcc
agcagctga

DBGET integrated database retrieval system