KEGG   Homo sapiens (human): 23191Help
Entry
23191             CDS       T01001                                 

Gene name
CYFIP1, P140SRA-1, SHYC, SRA-1, SRA1
Definition
cytoplasmic FMR1 interacting protein 1
Orthology
K05749  
cytoplasmic FMR1 interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Regulation of actin cytoskeleton
Class
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q11
AA seq 822 aa AA seqDB search
MAESLGSAELLRQLKSLGMERLLHAVNTFLRQSCTYLPLLTFGGKTSFVSLDVYGTEANC
SATSCSFPKAAATWPRRQAPGPLGELVRGPPDQGVAEQSFSHGLFEFGITNVPCIFSPPQ
MFPWIIQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESFFYTHLINFSET
LQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASMMEYVLYSLDLY
NDSAHYALTRFNKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVMAGSLLLDKRLRSEC
KNQGATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSLELAIGRFESED
LTSIVELDGLLEINRMTHKLLSRYLTLDGFDAMFREANHNVSAPYGRITLHVFWELNYDF
LPNYCYNGSTNRFVRTVLPFSQEFQRDKQPNAQPQYLHGSKALNLAYSSIYGSYRNFVGP
PHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRHEYGSPG
ILEFFHHQLKDIVEYAELKTVCFQNLREVGNAILFCLLIEQSLSLEEVCDLLHAAPFQNI
LPRVHVKEGERLDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLS
MFEVILTRIRSFLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCIPVGTHEFTVEQ
CFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVPLKKMVERIRKF
QILNDEIITILDKYLKSGDGEGTPVEHVRCFQPPIHQSLASS
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtccttgggctctgccgagctgctcaggcagctcaagtctctgggcatggag
aggctcttgcatgcggttaacacgtttctgaggcagtcgtgcacctacctacccctttta
acctttggtggtaagacatcatttgtttctcttgacgtttatggcacggaggcgaactgc
tccgctacaagttgttctttccccaaagcagcagcaacgtggccgcgtagacaggcaccc
ggacccctcggggagctggtgcggggccctcccgaccagggcgtagcggagcagtccttc
tctcatgggctttttgagtttggcataactaatgtaccatgtatattttctcccccacaa
atgtttccttggataatccagctttacatggtgagaaccatgctagagtccctcattgca
gacaaaagtggttccaagaaaaccttgagaagtagccttgaggggcccaccatattggac
atagaaaaatttcatcgagagtcattcttctacactcacttgataaatttcagtgaaacg
ctgcagcagtgctgtgacctttcgcagctgtggttccgagagttcttcctggagctgacc
atgggcaggaggatccagttccccattgagatgtcgatgccctggatcctgacggaccac
atcctggagaccaaggaggcatcgatgatggagtacgtgctctactccctggacctgtac
aatgacagcgcccactacgcgctcaccaggttcaacaagcagttcctgtacgacgaaatt
gaggccgaggtgaatctatgttttgaccaatttgtttacaagctagcagaccagatattt
gcctattataaggttatggcaggaagtttgcttcttgataaacggttacgatcagaatgc
aagaatcagggagccacgatccacctcccgccgtctaaccgctacgagacgctgctgaag
cagaggcatgtgcagctcctcggcagatcaatagacctcaatcgtctgatcacccagcgc
gtctcagcagccatgtataagtccctagaactggcgattggacgatttgaaagtgaagat
ttgacctccatagttgagctggatggcctgttggaaatcaaccgcatgacccacaagctg
ctgagccggtacctgacgctggacggcttcgacgccatgttccgggaggccaaccacaac
gtgtcagcgccctacgggaggatcaccctgcacgtcttctgggagctcaactatgacttc
ctgcccaactactgctacaacggctctaccaaccggtttgttcggacagtgttaccattt
tctcaggaatttcaaagagataagcagcctaatgcacagcctcagtatctgcatggatcc
aaggctttgaacttggcctactccagcatttacggcagctaccggaacttcgtgggacct
ccacactttcaagtcatctgccggcttctcggctaccagggtatcgccgtggtcatggag
gagctgctgaaggtcgtcaagagcctgctgcaaggcacaatcctgcagtacgtgaagacg
ctgatggaggtgatgcccaagatctgccgcctgccccggcacgagtacggctctcctggt
atcctggagttcttccaccaccagctgaaggacatcgtggagtacgcagagctgaagacg
gtgtgcttccagaacctgcgggaggtggggaacgccatcctcttctgcctgctcatcgag
cagagcctgtctttagaagaagtgtgtgacctgctgcacgcggctcctttccagaacatc
ttgccgcgagtccatgtgaaagagggggagagacttgatgccaaaatgaaaagactagaa
tcaaagtacgccccgctgcatcttgtcccactgattgaaagactggggacccctcagcaa
attgccatcgcaagagagggggacctgctgacaaaggagcgcctctgctgcggcctgtcc
atgtttgaggtcatcctgacacggatccggagctttctggatgaccccatctggcgcggg
cctctgcccagcaatggggtcatgcatgtggacgagtgtgtggagtttcacagactgtgg
agtgccatgcagtttgtctactgcattcccgtggggacacacgagttcacagtcgagcag
tgctttggtgatgggctacactgggctggctgtatgatcatcgtacttcttgggcagcag
cggcgttttgctgtgctggatttctgctaccatctacttaaagtccagaaacatgatggc
aaagatgagattattaaaaatgtgcctttgaagaagatggtggagagaattcgcaagttc
cagattctcaatgatgagatcatcaccatcctggataagtacctgaagtcaggcgacggg
gagggcacgccagtggagcatgtgcgctgcttccagccgcccatccaccagtccctcgcc
agcagctga

DBGET integrated database retrieval system