KEGG   Homo sapiens (human): 23192Help
Entry
23192             CDS       T01001                                 

Gene name
ATG4B, APG4B, AUTL1
Definition
autophagy related 4B, cysteine peptidase
Orthology
K08342  
cysteine protease ATG4 [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of autophagy
Class
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:hsa04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q37.3
AA seq 393 aa AA seqDB search
MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPA
IGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKD
SYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIR
RLCRTSVPCAGATAFPADSDRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYV
ETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFH
CQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLA
CPDVLNLSLDSSDVERLERFFDSEDEDFEILSL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggacgcagctactctgacctacgacactctccggtttgctgagtttgaagattttcct
gagacctcagagcccgtttggatactgggtagaaaatacagcattttcacagaaaaggac
gagatcttgtctgatgtggcatctagactttggtttacatacaggaaaaactttccagcc
attggggggacaggccccacctcggacacaggctggggctgcatgctgcggtgtggacag
atgatctttgcccaagccctggtgtgccggcacctaggccgagattggaggtggacacaa
aggaagaggcagccagacagctacttcagcgtcctcaacgcattcatcgacaggaaggac
agttactactccattcaccagatagcgcaaatgggagttggcgaaggcaagtccataggc
cagtggtacgggcccaacactgtcgcccaggtcctgaagaagcttgctgtcttcgatacg
tggagctccttggcggtccacattgcaatggacaacactgttgtgatggaggaaatcaga
aggttgtgcaggaccagcgttccctgtgcaggcgccactgcgtttcctgcagattccgac
cggcactgcaacggattccctgccggagctgaggtcaccaacaggccgtcgccatggaga
cccctggtacttctcattcccctgcgcctggggctcacggacatcaacgaggcctacgtg
gagacgctgaagcactgcttcatgatgccccagtccctgggcgtcatcggagggaagccc
aacagcgcccactacttcatcggctacgttggtgaggagctcatctacctggacccccac
accacgcagccagccgtggagcccactgatggctgcttcatcccggacgagagcttccac
tgccagcacccgccgtgccgcatgagcatcgcggagcttgacccgtccatcgctgtgggg
tttttctgtaagactgaagatgacttcaatgattggtgccagcaagtcaaaaagctgtct
ctgcttggaggtgccctgcccatgtttgagctggtggagctgcagccttcacatctggcc
tgccccgacgtcctgaacctgtccctagattcttctgatgtagagcgactggaaagattc
ttcgactcagaagatgaagactttgaaatcctgtccctttga

DBGET integrated database retrieval system