KEGG   Homo sapiens (human): 23195Help
Entry
23195             CDS       T01001                                 

Gene name
MDN1, Rea1
Definition
(RefSeq) midasin AAA ATPase 1
  KO
K14572  
midasin
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    23195 (MDN1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Other pre-60S particles
    23195 (MDN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9NU22(Tdark)
UniProt: 
Position
6q15
AA seq 5596 aa AA seqDB search
MEHFLLEVAAAPLRLIAAKNEKSRSELGRFLAKQVWTPQDRQCVLSTLAQLLLDKDCTVL
VGRQLRPLLLDLLERNAEAIKAGGQINHDLHERLCVSMSKLIGNHPDVLPFALRYFKDTS
PVFQRLFLESSDANPVRYGRRRMKLRDLMEAAFKFLQQEQSVFRELWDWSVCVPLLRSHD
TLVRWYTANCLALVTCMNEEHKLSFLKKIFNSDELIHFRLRLLEEAQLQDLEKALVLANP
EVSLWRKQKELQYLQGHLVSSDLSPRVTAVCGVVLPGQLPAPGELGGNRSSSREQELALR
SYVLVESVCKSLQTLAMAVASQNAVLLEGPIGCGKTSLVEYLAAVTGRTKPPQLLKVQLG
DQTDSKMLLGMYRCTDVPGEFVWQPGTLTQAATMGHWILLEDIDYAPLDVVSVLIPLLEN
GELLIPGRGDCLKVAPGFQFFATRRLLSCGGNWYRPLNSHATLLDKYWTKIHLDNLDKRE
LNEVLQSRYPSLLAVVDHLLDIYIQLTGEKHHSWSDSSVGCEQAPEEVSEARRENKRPTL
EGRELSLRDLLNWCNRIAHSFDSSSLSASLNIFQEALDCFTAMLSEHTSKLKMAEVIGSK
LNISRKKAEFFCQLYKPEIVINELDLQVGRVRLLRKQSEAVHLQREKFTFAATRPSSVLI
EQLAVCVSKGEPVLLVGETGTGKTSTIQYLAHITGHRLRVVNMNQQSDTADLLGGYKPVD
HKLIWLPLREAFEELFAQTFSKKQNFTFLGHIQTCYRQKRWHDLLRLMQHVHKSAVNKDG
KDSETGLLIKEKWEAFGLRLNHAQQQMKMTENTLLFAFVEGTLAQAVKKGEWILLDEINL
AAPEILECLSGLLEGSSGSLVLLDRGDTEPLVRHPDFRLFACMNPATDVGKRNLPPGIRN
RFTELYVEELESKEDLQVLIVDYLKGLSVNKNTVQGIINFYTALRKESGTKLVDGTGHRP
HYSLRTLCRALRFAASNPCGNIQRSLYEGFCLGFLTQLDRASHPIVQKLICQHIVPGNVK
SLLKQPIPEPKGGRLIQVEGYWIAVGDKEPTIDETYILTSSVKLNLRDIVRVVSAGTYPV
LIQGETSVGKTSLIQWLAAATGNHCVRINNHEHTDIQEYIGCYTSDSSGKLVFKEGVLID
AMRKGYWIILDELNLAPTDVLEALNRLLDDNRELLVTETQEVVKAHPRFMLFATQNPPGL
YGGRKVLSRAFRNRFVELHFDELPSSELETILHKRCSLPPSYCSKLVKVMLDLQSYRRSS
SVFAGKQGFITLRDLFRWAERYRLAEPTEKEYDWLQHLANDGYMLLAGRVRKQEEIDVIQ
EVLEKHFKKKLCPQSLFSKENVLKLLGKLSTQISTLECNFGHIVWTEGMRRLAMLVGRAL
EFGEPVLLVGDTGCGKTTICQVFAALANQKLYSVSCHLHMETSDFLGGLRPVRQKPNDKE
EIDTSRLFEWHDGPLVQAMKEDGFFLLDEISLADDSVLERLNSVLEVEKSLVLAEKGSPE
DKDSEIELLTAGKKFRILATMNPGGDFGKKELSPALRNRFTEIWCPQSTSREDLIQIISH
NLRPGLCLGRIDPKGSDIPEVMLDFIDWLTHQEFGRKCVVSIRDILSWVNFMNKMGEEAA
LKRPEIISTVTSFVHAACLVYIDGIGSGVTSSGFGTALLARKECLKFLIKRLAKIVRLTE
YQKNELKIYDRMKAKEFTGIDNLWGIHPFFIPRGPVLHRNNIADYALSAGTTAMNAQRLL
RATKLKKPILLEGSPGVGKTSLVGALAKASGNTLVRINLSEQTDITDLFGADLPVEGGKG
GEFAWRDGPLLAALKAGHWVVLDELNLASQSVLEGLNACFDHRGEIYVPELGMSFQVQHE
KTKIFGCQNPFRQGGGRKGLPRSFLNRFTQVFVDPLTVIDMEFIASTLFPAIEKNIVKKM
VAFNNQIDHEVTVEKKWGQKGGPWEFNLRDLFRWCQLMLVDQSPGCYDPGQHVFLVYGER
MRTEEDKKKVIAVFKDVFGSNSNPYMGTRLFRITPYDVQLGYSVLSRGSCVPHPSRHPLL
LLHQSFQPLESIMKCVQMSWMVILVGPASVGKTSLVQLLAHLTGHTLKIMAMNSAMDTTE
LLGGFEQVDLIRPWRRLLEKVEGTVRALLRDSLLISADDAEVVLRAWSHFLLTYKPKCLG
EGGKAITMEIVNKLEAVLLLMQRLNNKINSYCKAEFAKLVEEFRSFGVKLTQLASGHSHG
TFEWVDSMLVQALKSGDWLLMDNVNFCNPSVLDRLNALLEPGGVLTISERGMIDGSTPTI
TPNPNFRLFLSMDPVHGDISRAMRNRGLEIYISGEGDASTPDNLDLKVLLHSLGLVGNSV
CDILLALHTETRSTVVGSPTSSVSTLIQTAILIVQYLQRGLSLDRAFSEACWEVYVCSQH
SPANRKLVQALLEKHVSSLRAHETWGDSILGMGLWPDSVPSALFATEDSHLSTVRRDGQI
LVYCLNRMSMKTSSWTRSQPFTLQDLEKIMQSPSPENLKFNAVEVNTYWIDEPDVLVMAV
KLLIERATNQDWMLRVKWLYHLAKNIPQGLESIQIHLEASAASLRNFYSHSLSGAVSNVF
KILQPNTTDEFVIPLDPRWNMQALDMIRNLMDFDPQTDQPDQLFALLESAANKTIIYLDR
EKRVFTEANLVSVGSKKLRESVLRMSFEFHQDPESYHTLPHEIVVNLAAFFELCDALVLL
WVQSSQGMVSDASANEILGSLRWRDRFWTVADTVKVDAPGLALLALHWHWVLKHLVHQIP
RLLMNYEDKYYKEVQTVSEHIQNCLGSQTGGFAGIKKLQKFLGRPFPFKDKLVVECFSQL
KVLNKVLAIREQMSALGESGWQEDINRLQVVASQWTLKKSLLQAWGLILRANILEDVSLD
ELKNFVHAQCLELKAKGLSLGFLEKKHDEASSLSHPDLTSVIHLTRSVQLWPAMEYLAML
WRYKVTADFMAQACLRRCSKNQQPQINEEISHLISFCLYHTPVTPQELRDLWSLLHHQKV
SPEEITSLWSELFNSMFMSFWSSTVTTNPEYWLMWNPLPGMQQREAPKSVLDSTLKGPGN
LNRPIFSKCCFEVLTSSWRASPWDVSGLPILSSSHVTLGEWVERTQQLQDISSMLWTNMA
ISSVAEFRRTDSQLQGQVLFRHLAGLAELLPESRRQEYMQNCEQLLLGSSQAFQHVGQTL
GDMAGQEVLPKELLCQLLTSLHHFVGEGESKRSLPEPAQRGSLWVSLGLLQIQTWLPQAR
FDPAVKREYKLNYVKEELHQLQCEWKTRNLSSQLQTGRDLEDEVVVSYSHPHVRLLRQRM
DRLDNLTCHLLKKQAFRPQLPAYESLVQEIHHYVTSIAKAPAVQDLLTRLLQALHIDGPR
SAQVAQSLLKEEASWQQSHHQFRKRLSEEYTFYPDAVSPLQASILQLQHGMRLVASELHT
SLHSSMVGADRLGTLATALLAFPSVGPTFPTYYAHADTLCSVKSEEVLRGLGKLILKRSG
GKELEGKGQKACPTREQLLMNALLYLRSHVLCKGELDQRALQLFRHVCQEIISEWDEQER
IAQEKAEQESGLYRYRSRNSRTALSEEEEEEREFRKQFPLHEKDFADILVQPTLEENKGT
SDGQEEEAGTNPALLSQNSMQAVMLIHQQLCLNFARSLWYQQTLPPHEAKHYLSLFLSCY
QTGASLVTHFYPLMGVELNDRLLGSQLLACTLSHNTLFGEAPSDLMVKPDGPYDFYQHPN
VPEARQCQPVLQGFSEAVSHLLQDWPEHPALEQLLVVMDRIRSFPLSSPISKFLNGLEIL
LAKAQDWEENASRALSLRKHLDLISQMIIRWRKLELNCWSMSLDNTMKRHTEKSTKHWFS
IYQMLEKHMQEQTEEQEDDKQMTLMLLVSTLQAFIEGSSLGEFHVRLQMLLVFHCHVLLM
PQVEGKDSLCSVLWNLYHYYKQFFDRVQAKIVELRSPLEKELKEFVKISKWNDVSFWSIK
QSVEKTHRTLFKFMKKFEAVLSEPCRSSLVESDKEEQPDFLPRPTDGAASELSSIQNLNR
ALRETLLAQPAAGQATIPEWCQGAAPSGLEGELLRRLPKLRKRMRKMCLTFMKESPLPRL
VEGLDQFTGEVISSVSELQSLKVEPSAEKEKQRSEAKHILMQKQRALSDLFKHLAKIGLS
YRKGLAWARSKNPQEMLHLHPLDLQSALSIVSSTQEADSRLLTEISSSWDGCQKYFYRSL
ARHARLNAALATPAKEMGMGNVERCRGFSAHLMKMLVRQRRSLTTLSEQWIILRNLLSCV
QEIHSRLMGPQAYPVAFPPQDGVQQWTERLQHLAMQCQILLEQLSWLLQCCPSVGPAPGH
GNVQVLGQPPGPCLEGPELSKGQLCGVVLDLIPSNLSYPSPIPGSQLPSGCRMRKQDHLW
QQSTTRLTEMLKTIKTVKADVDKIRQQSCETLFHSWKDFEVCSSALSCLSQVSVHLQGLE
SLFILPGMEVEQRDSQMALVESLEYVRGEISKAMADFTTWKTHLLTSDSQGGNQMLDEGF
VEDFSEQMEIAIRAILCAIQNLEERKNEKAEENTDQASPQEDYAGFERLQSGHLTKLLED
DFWADVSTLHVQKIISAISELLERLKSYGEDGTAAKHLFFSQSCSLLVRLVPVLSSYSDL
VLFFLTMSLATHRSTAKLLSVLAQVFTELAQKGFCLPKEFMEDSAGEGATEFHDYEGGGI
GEGEGMKDVSDQIGNEEQVEDTFQKGQEKDKEDPDSKSDIKGEDNAIEMSEDFDGKMHDG
ELEEQEEDDEKSDSEGGDLDKHMGDLNGEEADKLDERLWGDDDEEEDEEEEDNKTEETGP
GMDEEDSELVAKDDNLDSGNSNKDKSQQDKKEEKEEAEADDGGQGEDKINEQIDERDYDE
NEVDPYHGNQEKVPEPEALDLPDDLNLDSEDKNGGEDTDNEEGEEENPLEIKEKPEEAGH
EAEERGETETDQNESQSPQEPEEGPSEDDKAEGEEEMDTGADDQDGDAAQHPEEHSEEQQ
QSVEEKDKEADEEGGENGPADQGFQPQEEEEREDSDTEEQVPEALERKEHASCGQTGVEN
MQNTQAMELAGAAPEKEQGKEEHGSGAADANQAEGHESNFIAQLASQKHTRKNTQSFKRK
PGQADNERSMGDHNERVHKRLRTVDTDSHAEQGPAQQPQAQVEDADAFEHIKQGSDAYDA
QTYDVASKEQQQSAKDSGKDQEEEEIEDTLMDTEEQEEFKAADVEQLKPEEIKSGTTAPL
GFDEMEVEIQTVKTEEDQDPRTDKAHKETENEKPERSRESTIHTAHQFLMDTIFQPFLKD
VNELRQELERQLEMWQPRESGNPEEEKVAAEMWQSYLILTAPLSQRLCEELRLILEPTQA
AKLKGDYRTGKRLNIRKVIPYIASQFRKDKIWLRRTKPSKRQYQICLAIDDSSSMVDNHT
KQLAFESLAVIGNALTLLEVGQIAVCSFGESVKLLHPFHEQFSDYSGSQILRLCKFQQKK
TKIAQFLESVANMFAAAQQLSQNISSETAQLLLVVSDGRGLFLEGKERVLAAVQAARNAN
IFVIFVVLDNPSSRDSILDIKVPIFKGPGEMPEIRSYMEEFPFPYYIILRDVNALPETLS
DALRQWFELVTASDHP
NT seq 16791 nt NT seq  +upstreamnt  +downstreamnt
atggagcacttcttgctggaggtggcagccgcgccgctgcggttaatcgcagccaagaac
gagaagagccgcagtgagttgggcaggttcttggccaagcaggtgtggacacctcaagat
cgccagtgtgtcctgagtaccttagcacagttgcttttggataaggactgtactgtgctg
gttggtcgccagcttcgccctctccttttggatttgctggaaaggaatgccgaagccatt
aaagctggaggccaaatcaaccatgatctgcatgaacggctatgtgtgtcgatgagcaaa
ctcattggtaaccatcctgatgtcctcccgtttgccctgagatatttcaaggacacatcc
ccagtctttcaaagacttttcctagagagttcagatgctaatccagtacgctatggacgt
aggaggatgaagctccgggacctaatggaagcagccttcaagtttctgcagcaggagcag
tctgtgttccgggagctctgggactggagtgtgtgtgtccctctcctcagaagccatgac
accttggttcgctggtatacagccaattgtcttgctttggttacctgtatgaatgaagag
cacaagttatcatttcttaagaagatatttaatagtgatgaattgatccatttcaggttg
aggttattagaagaggcccagttgcaggacttggagaaggccttggttttggccaatcca
gaagtctccctttggcgtaagcagaaggagctgcagtacttacagggacatcttgtttcg
tctgacctctcccctagggtgacagctgtttgtggtgtggtgctgcctgggcagctgcca
gcccctggagagctgggtggtaataggagttcttcacgtgaacaggagctggcccttagg
tcttatgtgctggttgagtctgtctgcaaaagtcttcagaccctggctatggcggttgct
tctcagaatgctgtgttgttggaaggaccaataggatgtggcaaaacttccttagttgaa
tatttagctgcagtgacaggtagaacaaagcctcctcagcttctcaaagtccagcttgga
gatcagactgacagtaagatgcttttggggatgtatcgctgcacagatgttcctggagag
tttgtgtggcagcctggcaccctgacacaggcagccacaatgggccactggatccttctg
gaggatattgactatgcccccttagacgtggtttctgtgctgatccctctcttggagaat
ggagagctcttgattcctggccgaggtgactgtctgaaagtggcacctggatttcagttt
tttgcaaccaggagactcttgagctgtggaggaaattggtatcgaccgctaaacagtcat
gctactttgctagacaaatattggaccaaaattcacctggataacctggataagagagaa
ctgaatgaggttcttcagagcagatatcctagcctattggcagtggttgatcacctgctt
gacatttatatccaacttactggagagaaacatcactcttggagtgatagttctgttgga
tgtgaacaggcacctgaagaagtttcagaagccagaagagaaaacaaaagaccaaccctt
gagggaagagaattatctctaagggatctgctgaattggtgtaataggattgcccatagc
tttgacagttcatctttatcagcatcattaaatatttttcaagaggctctagactgtttc
acagcaatgctttctgagcatacaagcaaactgaaaatggcagaagttattggaagcaaa
ttgaacatttctagaaaaaaggctgaattcttttgtcaactttataaaccagaaattgtg
atcaatgagctagatttgcaagtgggtcgagtgcggcttctacggaaacaaagtgaggct
gttcacctacagagggagaagttcactttcgctgctacacggccgtcctctgttctcatc
gagcagcttgcagtgtgtgtcagcaaaggggagcctgtgttgctggtgggagagaccggg
actggcaaaacctctaccatccaatacttggctcacattacaggccaccgtttgagggtt
gtcaatatgaatcaacaaagtgatactgcagacttgcttggaggttataaaccggtggac
cataagcttatttggctacccttacgggaggcatttgaggaactctttgctcagacattt
tccaagaaacaaaactttacgttcttggggcacattcagacctgttacagacagaaacgg
tggcatgatctcctgagactaatgcagcatgtacacaagtctgctgttaacaaggatgga
aaagacagtgaaactgggttactcataaaagagaaatgggaagcatttggtcttagactc
aaccatgcccaacaacagatgaaaatgactgaaaataccttattgttcgcatttgtagag
ggtacattagctcaggctgtaaagaaaggagagtggatcttgttggatgagattaacttg
gctgctccagaaatactagaatgtctgagtggtttgcttgaaggatcttctggatccctg
gtgttgctggatcgaggagacacagagccactggttcggcatcctgacttccgtttattt
gcctgtatgaatccagcaactgatgtaggcaaaagaaatctcccaccaggaataagaaac
aggttcacagaactttatgtagaagaattagaaagcaaagaagacttacaggttcttatt
gtagattatctgaaaggattgagtgtgaacaagaatacagtgcaaggaatcataaacttc
tacacagctttgcggaaagagtctgggaccaaactggtggatggcactggccatagacct
cactacagccttcggactctgtgccgggccctgcgatttgcagcctccaatccatgtggc
aacattcagcgctcactctatgagggtttttgtttgggtttcttaacacagcttgacagg
gcatcacacccaatagttcagaagctcatctgtcaacacattgtccctggcaatgtcaag
agtctgctgaagcagcctattccagagccaaaaggaggtcggcttatccaggttgaaggc
tactggattgcggtgggagacaaggagcctacaatagatgagacgtacattctgacatct
tctgtgaagctgaacctgagagatatagtccgagttgtctctgcaggaacctatccagtg
ctgattcagggagagacatcagttggtaaaacaagcctgatccagtggctggctgcagct
actggcaaccactgtgtgcgtattaataatcacgaacacacggatattcaggagtacatt
ggttgttacacgtctgactcctcagggaagcttgtctttaaggaaggtgttcttattgat
gccatgagaaaaggctattggattattttagatgaattaaatttggcccctactgatgtg
ttagaggcgctgaataggctgttggatgataaccgtgaattgctagtaacagaaacacag
gaagttgttaaagcacaccctcggtttatgctttttgccacccaaaatcccccaggactt
tatggaggcagaaaggtcctttctagagccttcaggaatcggtttgtggaattgcacttt
gatgagttacctagctccgagttggaaacaatcttgcacaagcggtgtagtttgccaccc
tcctattgcagcaagttggttaaagtcatgctggatcttcagtcctatcgcagaagttct
tcagtgtttgctggaaagcagggcttcatcacccttcgtgatctgttccgatgggctgaa
agatacagattggctgagccgaccgagaaggagtatgactggctacagcatttagccaat
gatggttatatgcttctggcaggtcgagtcaggaagcaggaggaaattgatgtgattcaa
gaagtccttgagaaacatttcaagaaaaaattgtgtcctcaatctcttttctccaaagaa
aatgttctaaaattgctgggtaaattgtctactcagatatccacattggagtgtaacttt
ggccatatcgtgtggactgagggcatgcggagactcgcgatgctagtgggaagggcattg
gaatttggtgaacctgtgctgctggttggagacactgggtgtgggaaaactactatctgt
caggtatttgcagccttggcaaatcagaaattatactctgtcagctgccacttacacatg
gagacatcagacttcctgggtggcctgcggccagtgagacaaaagccaaacgacaaggaa
gaaattgacacatcaagactctttgagtggcatgatgggcctctggttcaggccatgaag
gaggacggctttttcctcttggatgagatctcattggccgatgactctgtcttggaaaga
ctcaacagtgtccttgaagtagaaaagtctctggtattagctgaaaaaggcagtccagag
gacaaggatagtgaaatagagctgttgactgctgggaaaaaatttcgtattctagcaacc
atgaaccctgggggtgactttggaaaaaaggagctgtctcctgccttaagaaaccggttt
acagaaatatggtgccctcaaagcacaagccgtgaagatttaattcagatcatcagtcat
aatcttcgtccaggattgtgtctgggcagaatagatcctaaagggtctgacatacctgaa
gtgatgctggatttcattgactggctgacccaccaagagtttggcagaaagtgtgtggtc
agtatcagagatatcctgtcctgggttaacttcatgaacaaaatgggggaggaagctgct
ttgaaaaggccagagatcatctccactgtgacatcttttgtccatgctgcatgcctggtg
tacatagatggaataggttcaggggtaacttcctctgggtttggtacagcccttttggca
cgaaaagaatgtctgaaatttctaatcaagaggcttgccaagatagtacgacttacagaa
tatcagaaaaatgagttgaagatttatgacagaatgaaggccaaagaattcactggaata
gataacctttggggaattcatccattttttataccaaggggacctgtcctacacaggaat
aatattgcagactatgcactcagtgcagggaccactgctatgaatgcacagaggctctta
agagctaccaaactgaagaagcccattctcctggagggttcccctggtgttggcaagaca
agtttggtgggagcattagcaaaggcttcaggaaatacccttgttagaatcaacttatca
gagcaaacggacatcacagacctgtttggagcagatctacctgttgaaggtggcaaggga
ggagagtttgcctggcgtgatggccccttactggcagctttgaaggcaggccattgggtg
gtgttggatgagcttaacctggcttctcagtctgtattggaaggactcaatgcttgtttt
gaccaccgaggagaaatctatgtgcctgagttaggaatgagctttcaagtgcagcatgaa
aagacgaagatttttgggtgtcagaatccctttagacaaggaggtgggaggaaaggcttg
cccaggtctttccttaacagattcactcaggtcttcgttgatccccttacagtaattgac
atggagttcattgccagtactttgtttccagccattgagaaaaatattgttaagaaaatg
gttgctttcaataaccaaattgatcatgaagtgactgttgagaagaaatgggggcaaaaa
ggaggaccctgggaattcaacctccgggaccttttccgctggtgtcagttgatgctggtt
gaccagtcccctgggtgttatgatcctggtcagcatgtgtttttggtctatggtgaaaga
atgagaaccgaagaggacaaaaaaaaggtcattgctgtattcaaggatgtgtttggttca
aattccaacccatacatgggaaccagactatttcgtatcactccctatgatgttcagttg
ggctactcagtcctttcccgtgggagctgtgttcctcacccgtcccgccatcccctgttg
ctcctgcaccagtcattccaacccctggagtcaatcatgaagtgtgtgcagatgagctgg
atggtcatcctggtcgggccagcctctgtgggcaagaccagcctggtccagcttctggca
caccttactggccacacattaaagatcatggctatgaacagtgcaatggatactactgag
ctgctgggtggatttgagcaggttgatcttatacgaccttggaggaggctgctagagaag
gtggagggaactgtaagggcactgttaagggatagcctccttatcagtgctgatgatgca
gaagtagtgctgcgagcctggagtcattttcttctgacatataagcctaagtgtcttgga
gaaggtggtaaagctatcacgatggagattgtcaacaaactagaagcagtgttattgctt
atgcagcgactcaacaataaaatcaactcatactgcaaggcagagtttgccaaacttgtt
gaagagttccgaagctttggtgtgaagcttacgcagttggccagtggccatagccatggc
acatttgaatgggttgacagcatgttggttcaggccctgaagtctggagactggcttctg
atggacaatgttaacttctgcaacccatcagtgttggatcgtttgaatgctttgcttgaa
cccggaggtgtcctcactattagtgagagaggaatgatagatggatccactcccacgata
acaccaaatcccaatttcagacttttcctctcgatggatcctgttcatggagatatatcc
cgagctatgaggaatcgtggacttgaaatctacatttcaggggaaggggatgcaagcacc
ccagacaacctggatttgaaagttctgctgcacagccttggattggtggggaacagtgta
tgtgacatcctcttggctttacacacagagacccggagcactgttgtaggttctccaaca
tcttctgtatcaactctaatccagacagccatactaattgtccagtacctgcagcgaggg
ctgagtttagacagagccttttctgaagcatgctgggaagtatatgtctgttcccagcat
tcaccagcaaaccggaagcttgtacaggctttactggagaaacatgtttcttctttgcga
gcacatgaaacctggggagactccattcttggcatgggactgtggccagattctgtgccc
tcagctctctttgctactgaagattcacacctgtctacagtccgaagagatggacagatc
ttagtatattgtctcaacaggatgagcatgaaaaccagcagctggacaaggagtcagcct
tttaccttgcaagacttagagaaaattatgcagtcccccagccctgagaacctgaaattc
aatgcagtcgaagtgaatacttactggatcgatgaaccagatgttttggtcatggctgtt
aaattgctcatagaaagagcaaccaatcaggattggatgctcagagttaaatggctttat
catttagccaagaatataccgcaggggcttgagtccatacaaattcatttggaagccagt
gctgcatctctcaggaatttttactcacattccctctcaggtgcagtcagtaatgttttc
aaaatattacaaccaaatacaacagatgaatttgtgatccctctggatccccgatggaat
atgcaggctctggacatgattagaaatttgatggactttgacccacaaacggaccagcct
gaccagctctttgcccttttagaatcagctgcaaacaagacaatcatatatcttgaccgg
gaaaaacgggtttttactgaagcaaatttggtttctgttggtagcaaaaagctaagagag
agtgttttgagaatgtcctttgaattccatcaagatccagaaagctatcacactctgccc
catgaaattgtggtcaatcttgctgctttttttgaactttgtgatgcactagtcctgctc
tgggtacagtcctcccagggaatggtgtctgatgccagtgccaatgagatcttaggttct
ctgcggtggcgggaccggttctggactgtggccgacacagtaaaagtagatgccccaggt
ctggcccttcttgccctccattggcactgggttttaaaacatctggtccaccagatcccc
cgacttctgatgaattatgaagacaaatattacaaagaagttcagactgtctcagaacat
attcagaattgtctggggagccagactggtggcttcgctggtataaagaagttgcagaag
ttcctgggacgaccgtttccttttaaggacaagctggtggtggagtgtttttcacaactg
aaggtccttaacaaagtccttgccatcagggagcagatgtctgcccttggggagagtgga
tggcaggaagacattaaccgtctccaagtggttgcttctcagtggacattaaagaaaagt
ctcctgcaagcctggggactgatcctcagagcaaatattttggaagatgtcagcctagat
gaattgaagaattttgtgcatgctcagtgtttagaactgaaagccaaaggactctcactt
ggttttctggagaaaaagcatgatgaagcttcctccctgtcccatccagacttgacctcc
gtaatccacctcaccaggagtgttcagttgtggcctgcaatggagtacctggctatgctt
tggcggtacaaagtgacagctgattttatggcacaagcttgtctcagaagatgcagcaaa
aatcaacaaccccagataaatgaggagataagtcacctcatctcattttgtctttatcac
acacctgttacacctcaagagcttcgagatctgtggtccttgctgcatcatcagaaggtg
tctcctgaagaaattacatctttgtggtccgagttatttaattccatgtttatgtctttc
tggagcagtactgtgaccacaaatccagagtactggctaatgtggaaccctttgcctggt
atgcagcagagggaggcacccaagtctgttttggactccacattgaagggccccggcaat
ctcaatagacccatattctctaagtgctgctttgaagtcttaaccagcagctggagagca
agtccctgggatgtgagtggcctccccattctttcctcctctcacgtgaccctaggagag
tgggttgagagaactcagcagctccaggacatcagttcgatgctttggactaacatggct
atctcttcagtagcagaattcagacgcacggattcccaactccaggggcaggtgctgttc
cggcacctggcaggcctagcagagctgctcccagagtcccggcggcaggagtacatgcag
aactgtgagcagctgctgcttgggagcagccaggccttccagcatgtgggccagacactt
ggggacatggctggtcaggaggtgctgcccaaggaactgctctgccagttgctcacctcc
ctgcaccactttgttggtgaaggggagagtaagaggagcctgcctgagccagcccagcgt
gggagcctctgggtgagcctcggcttgctccagattcagacatggcttccccaggcacgc
tttgaccctgcggtgaagagggagtacaagctcaattacgtcaaggaagagttacaccaa
ctgcagtgtgaatggaagacccggaacctgtcatcccagctgcagactggaagagacctg
gaagatgaagtcgttgtcagctactctcatcctcacgtcaggctgcttcgccaaaggatg
gatcggctggataatttaacctgtcacctgttgaagaaacaggcctttagaccccagctg
cctgcctacgagtccctggttcaggagatccaccactacgtcaccagcatcgccaaggcc
cctgctgttcaggatctgctcacacggcttctgcaggccctccacatagatgggccacgg
tctgcccaagtagcccagagccttctaaaggaggaggcctcttggcagcagtcacaccac
cagttccggaagcggctgtcagaggagtacaccttctatccagatgccgtgagcccactg
caggcatccatattgcagttacaacatggcatgaggctggtggcctctgagctccacacc
tcactccacagcagtatggttggtgcagacaggctggggaccctggccacagccttgctg
gctttcccatcggtgggccccaccttcccgacttactatgctcatgcagacactttgtgc
tcggtgaagtctgaggaggttctacgaggccttgggaagctaatcctcaagcgctcagga
ggaaaggagctggaaggcaagggccagaaagcctgtcccactcgggagcagctgctgatg
aatgctctcctttacctgcgctcccacgtgttatgcaagggagagttggaccagagggcc
ctgcagctcttcagacatgtgtgtcaggaaatcatcagtgagtgggatgagcaggaacgc
atagcccaagagaaggctgagcaggaaagcggcctgtatagatacaggagcaggaactct
aggacagccctgagtgaagaggaggaggaagaacgggagttcagaaaacagttccccctg
catgaaaaggactttgcagatattttggtgcagccaacgttggaggagaacaaaggaact
tcagatgggcaagaagaggaagcaggcacaaacccagctctcctctcccagaattcaatg
caggcagtaatgctgatacaccagcaattgtgtctcaactttgctcgatccctctggtat
caacagactctgccgccacatgaagcaaagcattacctcagcctgtttctgtcttgctat
cagactggggcatcgcttgtgacacacttctaccccctgatgggagttgaactgaatgac
cgactcttgggcagccaacttttggcctgtaccctctcccataacactctttttggggag
gcaccctcagacctgatggtgaaacctgatgggccctatgacttctaccagcatcccaat
gttccagaagcacggcagtgtcaacctgtgcttcaaggtttctcagaggctgtcagtcac
ttgctacaggactggccagaacacccagcgcttgaacagctcctggttgtaatggacaga
attcgtagtttcccactttccagtcccatctcaaagttcctgaatggcttagagatcctt
ctggcaaaggcacaggattgggaggaaaatgcaagtcgagctttgtctttgcggaaacat
cttgatttgatcagtcagatgatcattcggtggcgtaaactggagctgaactgctggtcc
atgagtttggataatactatgaagcgccacaccgagaaatccaccaagcactggttctcc
atctatcagatgcttgagaagcacatgcaggaacaaacagaagaacaggaagatgacaaa
cagatgaccttgatgttgctggtcagcacattacaagcatttattgaaggatcctcgctg
ggagagttccatgtgcgacttcagatgttactggttttccattgtcatgtcttgctgatg
ccacaggttgaaggaaaggattcactttgcagtgttctatggaatttgtaccattattac
aagcaattctttgaccgggtccaggccaaaattgtggaacttcgttcccccctagaaaaa
gaacttaaagaatttgttaagatttccaagtggaatgatgtcagcttctggtccattaag
caatctgtagaaaagacacacaggacactctttaaattcatgaagaaatttgaagcagtc
ctgagtgaaccctgccggtcatccctggtggagagtgacaaggaagaacagcctgacttt
ttgcccaggccaacagatggagctgcaagtgaactgtcttccattcagaatctgaacagg
gcactgagggagaccctgttagcccaaccagcagctgggcaggccacaattccagagtgg
tgtcagggcgctgctccttccggcttggaaggggagcttctgcgtcgcttgccaaagctc
aggaaacgcatgaggaagatgtgcctgacgttcatgaaggagagccccctgcctcgcctt
gtggagggccttgatcagttcacaggtgaagtgatttcctctgtgagtgagctgcagagc
ttaaaggtggaaccctctgcagagaaggagaagcagcggtcagaagccaagcacattctc
atgcaaaaacagcgagctttgtcagacctctttaaacaccttgcaaaaattggtttgtcg
tatcgcaaaggtcttgcttgggcccgttcaaaaaaccctcaagagatgcttcatcttcac
ccattagatctccagagcgcattgtccatcgtcagcagcactcaggaggctgattctagg
ctgcttacagaaatctcgtcttcatgggatggatgccagaagtatttttatcgctctctt
gcacggcatgccaggcttaacgcagcactagcaactcctgccaaggaaatgggcatgggc
aacgtggagaggtgcagagggttctcagcacatttgatgaagatgctcgtccgacagcgg
cgctccctgaccacgctcagtgagcagtggatcatcctcaggaacctcctcagctgtgtg
caagagattcacagcaggctgatggggccccaggcctaccccgtggccttcccccctcag
gatggcgtgcagcagtggacagagcgcctgcagcacctggccatgcagtgccagatcctg
cttgagcagctctcctggctcctccagtgctgccccagtgtagggccagctccaggccat
ggcaatgtccaggtactggggcagcctcctggcccctgcctggaaggaccagaacttagc
aagggacaactttgtggagtagtgctggacctaattccttccaatctgagctacccatct
ccaatacctggaagtcagctgccctctggttgccggatgcggaaacaggatcacctttgg
caacagtcaactacgagattaacagagatgctaaaaaccattaaaacagtgaaagctgac
gtcgacaaaattagacagcagtcttgtgagactctctttcattcttggaaagattttgaa
gtttgctcttctgcgctgagttgcttgtcccaggtgtcagttcatttgcagggcctagag
tccttgttcattcttccagggatggaggttgagcaaagagactcacaaatggcactagtt
gaaagtctggaatatgtaagaggagaaattagtaaagccatggctgactttactacctgg
aagacccatctgcttacttcagatagccaaggaggaaatcaaatgttggacgaaggattt
gtggaagatttttcagagcaaatggaaattgccatccgagccatcctctgtgccatccag
aacttagaagaaagaaagaatgaaaaagcagaggagaacactgaccaagcaagcccacaa
gaagattatgcaggctttgagagactgcaatcaggacatctaacaaaactcttagaggat
gacttctgggccgatgtgagcactttgcacgtgcagaaaataatttctgccatctccgag
ctgttggagaggctgaaatcgtacggtgaggatggcacagcagcaaagcacctgttcttc
agccaatcctgttccttgctggtgcgcctggtgccggtcctctccagctactcagacctc
gtcctcttcttcctgaccatgtctttagcaactcaccgtagtactgcaaagctgctctct
gtgcttgcccaggtctttacagagcttgcccagaagggattttgcttgcccaaagaattt
atggaagattcagctggagagggagcaactgagttccatgactatgagggaggtggaatt
ggagaaggcgagggcatgaaggatgtgagtgaccagatcggaaatgaagaacaggtggaa
gatacatttcagaagggtcaagaaaaagacaaagaggatcctgattcaaaatctgatatt
aagggcgaggataatgccattgagatgtcggaagattttgatgggaaaatgcatgatggg
gagcttgaagaacaagaagaggatgatgagaaatcagatagtgagggcggagacctggat
aaacacatgggcgatctcaatggtgaggaagctgacaaactagatgagaggctttggggt
gatgatgatgaggaggaagatgaggaggaagaagacaataaaactgaagaaacaggacca
ggaatggatgaggaagattctgaacttgttgctaaagatgacaacttggatagtggcaat
tcaaacaaagataaaagccagcaagataagaaggaagaaaaggaagaagcagaagctgat
gatggtggacaaggtgaagacaaaattaatgaacaaatagatgagagggactatgatgaa
aatgaggtggacccttaccatggcaatcaggaaaaggtgccagaacccgaggctttggac
cttccagatgacttgaacctcgacagtgaagacaagaatggtggtgaggacaccgacaat
gaagaaggagaagaagagaatcctttggagataaaagaaaaaccagaagaagcaggtcat
gaagctgaggaaagaggagagaccgagaccgaccagaacgaaagtcagagtccacaggag
cctgaggaaggccccagtgaagatgacaaggcagaaggggaagaggaaatggacacagga
gctgatgaccaagatggagatgctgctcagcatcctgaagaacactctgaggagcagcag
cagtctgtggaggaaaaagacaaggaagccgatgaagaaggtggagagaatggccctgct
gaccaaggtttccagccccaggaggaagaagaacgggaggactctgatacagaggagcag
gtgccagaggctttggagaggaaggagcatgcctcctgtgggcagactggtgtggagaac
atgcagaacacacaggccatggagctggctggggccgcacctgagaaggagcaggggaaa
gaggaacacggaagtggagctgcagatgcaaaccaggcagaaggccatgaatcgaatttc
attgcccagttggcctcccagaagcacaccaggaaaaacacacagagttttaagaggaaa
cctgggcaggctgacaatgaacgttccatgggtgatcacaatgagcgtgtgcacaagagg
ctgaggactgtggatacggacagccatgccgagcaggggccagctcagcagccccaggcc
caggtggaggatgcagatgcattcgagcacattaaacaaggcagtgacgcatacgatgca
cagacctatgatgtggccagcaaagaacagcaacagtctgcaaaagactctggcaaagat
caggaagaggaggagatagaggacacccttatggacacagaggagcaggaggagttcaaa
gcagcagacgtggagcagctgaagccagaggaaatcaagtcgggcaccacagcacccttg
ggctttgatgagatggaagtggagatccaaactgttaaaacagaggaagaccaagacccc
agaacagacaaagcccataaggagacagaaaatgagaaaccagaaagaagccgagagtct
accattcatacagctcatcaattcctcatggacacgatcttccagccctttttaaaagat
gtcaatgagctaagacaggagctggagagacagctggaaatgtggcagccacgtgaatct
ggaaacccagaggaggagaaggttgcagctgagatgtggcagagttacctgatcttaaca
gcgcctctttcacaacggttatgtgaagagcttcgtctcatattagagcctacccaggca
gccaagctgaaaggagactatcgaactgggaaacgactaaacatacggaaagtcattcca
tacattgctagtcaatttcggaaagacaagatttggcttcgaaggaccaagcccagtaaa
cgccagtatcagatttgtttggctatcgatgactcttctagtatggtagacaatcatacc
aagcagcttgcatttgaatctttggctgtgattggaaatgctctaaccctcctggaagtg
ggtcagattgcagtgtgtagttttggagaatctgtaaagctgttacacccatttcatgag
cagttcagtgattactctgggtcccagattctacgtctctgcaaattccaacaaaagaaa
accaagattgctcagtttctagagtctgttgccaacatgtttgcagctgctcagcagctc
tcgcagaacatcagttcagaaactgcacaactcctcctggtagtctctgatgggcgaggc
cttttccttgagggcaaagaaagagtcctggcagcagttcaggctgcccggaatgcaaat
atctttgtcatctttgttgtattggacaatcccagttcacgggattctatcttggacatt
aaagtaccgatatttaaaggacctggagagatgcctgaaatccgatcctacatggaagag
ttcccattcccatactatatcattcttcgagatgtaaacgcacttcctgagacactcagc
gatgccctcagacagtggtttgagttggtgacagcctctgaccacccatag

DBGET integrated database retrieval system