KEGG   Homo sapiens (human): 23205Help
Entry
23205             CDS       T01001                                 

Gene name
ACSBG1, BG, BG1, BGM, GR-LACS, LPD
Definition
(RefSeq) acyl-CoA synthetase bubblegum family member 1 (EC:6.2.1.3)
  KO
K15013  
long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid biosynthesis
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
PPAR signaling pathway
Adipocytokine signaling pathway
Module
beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    23205 (ACSBG1)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    23205 (ACSBG1)
   00071 Fatty acid degradation
    23205 (ACSBG1)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    23205 (ACSBG1)
   03320 PPAR signaling pathway
    23205 (ACSBG1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     23205 (ACSBG1)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   23205 (ACSBG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q23-q24
AA seq 724 aa AA seqDB search
MPRNSGAGYGCPHGDPSMLDSRETPQESRQDMIVRTTQEKLKTSSLTDRQPLSKESLNHA
LELSVPEKVNNAQWDAPEEALWTTRADGRVRLRIDPSCPQLPYTVHRMFYEALDKYGDLI
ALGFKRQDKWEHISYSQYYLLARRAAKGFLKLGLKQAHSVAILGFNSPEWFFSAVGTVFA
GGIVTGIYTTSSPEACQYIAYDCCANVIMVDTQKQLEKILKIWKQLPHLKAVVIYKEPPP
NKMANVYTMEEFMELGNEVPEEALDAIIDTQQPNQCCVLVYTSGTTGNPKGVMLSQDNIT
WTARYGSQAGDIRPAEVQQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCFAEPDALKGSL
VNTLREVEPTSHMGVPRVWEKIMERIQEVAAQSGFIRRKMLLWAMSVTLEQNLTCPGSDL
KPFTTRLADYLVLAKVRQALGFAKCQKNFYGAAPMMAETQHFFLGLNIRLYAGYGLSETS
GPHFMSSPYNYRLYSSGKLVPGCRVKLVNQDAEGIGEICLWGRTIFMGYLNMEDKTCEAI
DEEGWLHTGDAGRLDADGFLYITGRLKELIITAGGENVPPVPIEEAVKMELPIISNAMLI
GDQRKFLSMLLTLKCTLDPDTSDQTDNLTEQAMEFCQRVGSRATTVSEIIEKKDEAVYQA
IEEGIRRVNMNAAARPYHIQKWAILERDFSISGGELGPTMKLKRLTVLEKYKGIIDSFYQ
EQKM
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgccacgcaattctggagctggatacggctgcccacacggggaccccagcatgctggac
agcagagagaccccacaggagagccggcaggacatgattgtgaggaccacccaagaaaaa
ttgaaaaccagctcactgactgacaggcagccactctccaaagagtccctgaaccatgct
ctcgagctctcagtgccagagaaggtgaataatgcccagtgggatgctccagaggaggcg
ctgtggacgactcgggccgatgggcgggtgcgcctgcgcatagaccccagctgcccacag
cttccctacactgtgcatcggatgttctacgaggccctggataagtatggggacctcatc
gctttgggcttcaagcgccaggacaagtgggaacacatctcctactcccaatactacctg
ctcgcccgcagagccgccaagggcttcctgaagctcggcctgaagcaggcccacagtgtg
gccatcctcggcttcaactccccggagtggttcttctcggcagtgggcacagtatttgca
ggtggcatcgtcactggcatctacaccaccagctccccagaggcctgccagtacatcgct
tatgactgctgcgccaatgtcatcatggtcgacacgcagaagcagctggaaaagatcctg
aagatctggaaacagttgccacatctaaaggcagtcgtgatatataaagaacctcctcca
aacaagatggccaatgtgtacacgatggaggaattcatggagctggggaatgaagtgcct
gaggaagccctggacgccatcattgacacccagcagcccaaccagtgctgtgtgctagtc
tacacttccggcaccactgggaaccccaagggcgtgatgctgagtcaagacaatatcacg
tggacggcacggtacggcagccaggccggtgacatccggccggcagaagtccagcaggag
gtggtagtcagctacctgcccctcagccatattgccgcccagatctacgacctgtggaca
ggcatccagtggggggcccaggtttgctttgccgaacccgacgccctgaaggggagcctg
gtgaacacgctgcgggaggtggagcccacatcacacatgggggtgccccgggtatgggag
aagatcatggagcgcatccaggaggtggcggctcagtctggcttcatccggcgaaagatg
ctgctgtgggccatgtcggtgaccttggagcagaacctcacctgccccggcagcgacctg
aagcccttcacaaccagactggcagattacctggtgctagccaaggttcgccaggcactg
ggatttgccaagtgtcaaaagaacttctatggagcggcccccatgatggcagagacacag
cacttcttcctgggtctcaacatccgcttgtatgcgggctacggcctcagtgagacctca
ggcccccacttcatgtccagtccctacaactaccggctgtacagctcaggcaagttggtg
cccggctgtcgggtgaagctggtgaaccaggacgcagagggcattggcgagatctgcctg
tggggccgcaccatattcatgggctacctgaacatggaggacaagacttgtgaggccatc
gacgaggaaggctggctgcacacgggtgatgctggccgcctggacgccgatggcttcctc
tacatcactgggcgcctcaaagaattaatcatcacagctggtggggagaatgtgccccct
gtgcccatcgaggaggccgtgaagatggagctgcccatcatcagcaacgccatgctcatt
ggggaccagaggaagttcctgtccatgctgctcaccttgaagtgcactctggacccagac
acctctgaccagactgataatctgactgaacaagctatggagttctgccagagggtgggc
agcagagccaccacagtgtccgagatcatagagaagaaggatgaggccgtgtaccaggcc
atcgaagaggggatccggagggtcaacatgaacgcggcggcccggccctaccacatccag
aagtgggccattctcgagagagacttctccatttcgggtggagagttgggtcccacgatg
aaactgaaacggctcacagttttggagaagtacaaaggtatcattgactccttttaccaa
gagcaaaaaatgtaa

DBGET integrated database retrieval system