KEGG   Homo sapiens (human): 23212Help
Entry
23212             CDS       T01001                                 

Gene name
RRS1
Definition
(RefSeq) ribosome biogenesis regulator homolog
  KO
K14852  
regulator of ribosome biosynthesis
Organism
hsa  Homo sapiens (human)
Brite
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Other pre-60S particles
    23212 (RRS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q15050(Tbio)
UniProt: 
Position
8q13.1
AA seq 365 aa AA seqDB search
MEGQSVEELLAKAEQDEAEKLQRITVHKELELQFDLGNLLASDRNPPTGLRCAGPTPEAE
LQALARDNTQLLINQLWQLPTERVEEAIVARLPEPTTRLPREKPLPRPRPLTRWQQFARL
KGIRPKKKTNLVWDEVSGQWRRRWGYQRARDDTKEWLIEVPGNADPLEDQFAKRIQAKKE
RVAKNELNRLRNLARAHKMQLPSAAGLHPTGHQSKEELGRAMQVAKVSTASVGRFQERLP
KEKVPRGSGKKRKFQPLFGDFAAEKKNQLELLRVMNSKKPQLDVTRATNKQMREEDQEEA
AKRRKMSQKGKRKGGRQGPGGKRKGGPPSQGGKRKGGLGGKMNSGPPGLGGKRKGGQRPG
GKRRK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggagggccagagcgtggaggagctgctcgcaaaggcagagcaggacgaggcagagaag
ttgcaacgcatcacggtgcacaaggagctggagctgcagtttgacctgggcaacctgctg
gcgtcggaccggaaccccccgaccgggctgcggtgcgccggacccacgccggaggccgag
ctacaggccctggcgcgggacaacacgcaactgctcatcaaccagctgtggcagctgccc
acggagcgcgtggaagaggcgatagtggcgcggctgccggagcccaccacacgcctgccg
cgagagaagcctctgccccgaccgcggccacttacacgctggcagcagttcgcgcgcctc
aagggcatccgtcccaagaagaagaccaacctggtgtgggacgaggtgagtggccagtgg
cggcggcgctggggctaccagcgcgcccgggacgacaccaaagaatggctgattgaggtg
cccggcaatgccgaccccttggaggaccagttcgccaagcggattcaggccaagaaggaa
agggtggccaagaacgagctgaaccggctgcgtaacctggcccgcgcgcacaagatgcag
ctgcccagcgcggccggcttgcaccctaccggacaccagagtaaggaggagctgggccgc
gccatgcaagtggccaaggtctccaccgcctctgtggggcgctttcaggagcgcctcccc
aaggagaaggtgccccggggctccggcaagaaaaggaagtttcaaccccttttcggggac
tttgcagccgagaaaaagaaccagttggagctgcttcgtgtcatgaacagcaagaagcct
cagctggatgtgactagggccaccaataagcagatgagggaggaggaccaggaggaggcc
gccaagaggaggaaaatgagccagaagggcaagagaaagggaggccggcaggggcctggg
ggcaagaggaaagggggcccgcccagccagggagggaagaggaaagggggcttgggaggc
aagatgaattctgggccgcctggcttgggtggcaagagaaaaggaggacagcgcccagga
ggaaagaggaggaagtaa

DBGET integrated database retrieval system