KEGG   Homo sapiens (human): 23220Help
Entry
23220             CDS       T01001                                 

Gene name
DTX4, RNF155
Definition
deltex 4, E3 ubiquitin ligase
Orthology
K06058  
deltex
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    23220 (DTX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
11q12.1
AA seq 619 aa AA seqDB search
MLLASAVVVWEWLNEHGRWRPYSPAVSHHIEAVVRAGPRAGGSVVLGQVDSRLAPYIIDL
QSMNQFRQDTGTLRPVRRNYYDPSSAPGKGVVWEWENDNGSWTPYDMEVGITIQHAYEKQ
HPWIDLTSIGFSYVIDFNTMGQINRQTQRQRRVRRRLDLIYPMVTGTLPKAQSWPVSPGP
ATSPPMSPCSCPQCVLVMSVKAAVVNGSTGPLQLPVTRKNMPPPGVVKLPPLPGSGAKPL
DSTGTIRGPLKTAPSQVIRRQASSMPTGTTMGSPASPPGPNSKTGRVALATLNRTNLQRL
AIAQSRVLIASGVPTVPVKNLNGSSPVNPALAGITGILMSAAGLPVCLTRPPKLVLHPPP
VSKSEIKSIPGVSNTSRKTTKKQAKKGKTPEEVLKKYLQKVRHPPDEDCTICMERLTAPS
GYKGPQPTVKPDLVGKLSRCGHVYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPP
GKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKG
RKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNV
LAELAAQGISEDSTAQEKD
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggcctcggccgtggtggtctgggaatggctgaacgagcacggccgctggcgt
ccctacagcccagcggtgagccaccacatcgaggcggtggtccgcgccggcccccgcgcg
gggggcagcgtggtgctgggccaggtggacagccgtctcgcgccctacatcatcgacctg
cagtccatgaaccagttccgccaagacacgggaactctccgcccagttcgccgcaactac
tacgacccctcctcggcccctgggaagggcgtggtgtgggagtgggagaacgacaatggc
tcctggacgccctacgacatggaagtgggcatcaccatccagcatgcctatgagaagcag
cacccctggatcgacctcacttccattggctttagctacgtaattgacttcaacaccatg
ggccagatcaaccgtcagacccagcgccaacgccgcgtccgccggcgcctcgacctcatc
taccccatggtcacagggaccttgcctaaggctcagtcctggccagtcagccctgggcca
gccacctcgccccccatgtccccctgctcctgtccccagtgtgtcttggtgatgagtgtt
aaggcagccgtggtcaatggcagcactgggcccctacagctgccagtgacccgcaagaac
atgccgcctcctggagtggtcaagctacccccactgccaggctctggggccaagccactg
gacagcacaggcaccattcgaggcccactgaagaccgccccatcgcaggtgatccggaga
caagcctccagcatgcccactgggacaaccatgggctctcctgccagtcccccaggaccc
aacagcaagaccggaagggtggccctggccaccttgaatcgtaccaacctgcagcgactg
gccattgcccagtcccgggtgctgatcgcctctggggtccccacagtcccagtgaagaac
ctaaatgggtccagtcctgtcaaccctgccttggcaggaatcactgggatcctcatgagt
gcagcggggctgcctgtgtgtctcaccaggccaccaaagctggtcctacacccacccccc
gtcagcaagagtgaaataaaatccatcccaggggtttccaacacaagccgcaagaccacc
aaaaaacaagccaagaaaggtaaaaccccagaggaagtgctaaaaaaatatctacagaaa
gtccggcacccaccagatgaggactgcaccatctgtatggaacgcctcacggccccctca
ggctacaagggcccgcagcctacggtaaaacctgacctggtagggaagctgtccagatgc
ggccacgtctaccacatctactgcttggttgccatgtacaacaatgggaacaaggatgga
agtttgcagtgtccaacctgcaagaccatttatggggtgaagacaggcacccaacctcca
gggaagatggagtaccacctcatcccccactccttgcctggccacccagactgcaaaacc
atccggatcatctacagcatcccccccggcattcagggaccggaacacccgaatcctggg
aagagtttcagcgcccgaggcttcccacgacactgttaccttccggacagcgagaaaggg
agaaaagttctgaagctgctgctcgtggcctgggatcgccgcctcatttttgccattggc
acctccagcaccacaggcgagtcagacaccgtcatctggaatgaggtccaccacaagaca
gagtttggctctaatctcactggccatggctacccagatgccaattacctggataatgtg
ctggctgaactggctgcccagggcatctctgaggacagcactgcccaggagaaggactga

DBGET integrated database retrieval system