KEGG   Homo sapiens (human): 23220Help
Entry
23220             CDS       T01001                                 

Gene name
DTX4, RNF155
Definition
deltex homolog 4 (Drosophila)
Orthology
K06058  
deltex
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:hsa04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
11q12.1
AA seq 619 aa AA seqDB search
MLLASAVVVWEWLNEHGRWRPYSPAVSHHIEAVVRAGPRAGGSVVLGQVDSRLAPYIIDL
QSMNQFRQDTGTLRPVRRNYYDPSSAPGKGVVWEWENDNGSWTPYDMEVGITIQHAYEKQ
HPWIDLTSIGFSYVIDFNTMGQINRQTQRQRRVRRRLDLIYPMVTGTLPKAQSWPVSPGP
ATSPPMSPCSCPQCVLVMSVKAAVVNGSTGPLQLPVTRKNMPPPGVVKLPPLPGSGAKPL
DSTGTIRGPLKTAPSQVIRRQASSMPTGTTMGSPASPPGPNSKTGRVALATLNRTNLQRL
AIAQSRVLIASGVPTVPVKNLNGSSPVNPALAGITGILMSAAGLPVCLTRPPKLVLHPPP
VSKSEIKSIPGVSNTSRKTTKKQAKKGKTPEEVLKKYLQKVRHPPDEDCTICMERLTAPS
GYKGPQPTVKPDLVGKLSRCGHVYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPP
GKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKG
RKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNV
LAELAAQGISEDSTAQEKD
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggcctcggccgtggtggtctgggaatggctgaacgagcacggccgctggcgt
ccctacagcccagcggtgagccaccacatcgaggcggtggtccgcgccggcccccgcgcg
gggggcagcgtggtgctgggccaggtggacagccgtctcgcgccctacatcatcgacctg
cagtccatgaaccagttccgccaagacacgggaactctccgcccagttcgccgcaactac
tacgacccctcctcggcccctgggaagggcgtggtgtgggagtgggagaacgacaatggc
tcctggacgccctacgacatggaagtgggcatcaccatccagcatgcctatgagaagcag
cacccctggatcgacctcacttccattggctttagctacgtaattgacttcaacaccatg
ggccagatcaaccgtcagacccagcgccaacgccgcgtccgccggcgcctcgacctcatc
taccccatggtcacagggaccttgcctaaggctcagtcctggccagtcagccctgggcca
gccacctcgccccccatgtccccctgctcctgtccccagtgtgtcttggtgatgagtgtt
aaggcagccgtggtcaatggcagcactgggcccctacagctgccagtgacccgcaagaac
atgccgcctcctggagtggtcaagctacccccactgccaggctctggggccaagccactg
gacagcacaggcaccattcgaggcccactgaagaccgccccatcgcaggtgatccggaga
caagcctccagcatgcccactgggacaaccatgggctctcctgccagtcccccaggaccc
aacagcaagaccggaagggtggccctggccaccttgaatcgtaccaacctgcagcgactg
gccattgcccagtcccgggtgctgatcgcctctggggtccccacagtcccagtgaagaac
ctaaatgggtccagtcctgtcaaccctgccttggcaggaatcactgggatcctcatgagt
gcagcggggctgcctgtgtgtctcaccaggccaccaaagctggtcctacacccacccccc
gtcagcaagagtgaaataaaatccatcccaggggtttccaacacaagccgcaagaccacc
aaaaaacaagccaagaaaggtaaaaccccagaggaagtgctaaaaaaatatctacagaaa
gtccggcacccaccagatgaggactgcaccatctgtatggaacgcctcacggccccctca
ggctacaagggcccgcagcctacggtaaaacctgacctggtagggaagctgtccagatgc
ggccacgtctaccacatctactgcttggttgccatgtacaacaatgggaacaaggatgga
agtttgcagtgtccaacctgcaagaccatttatggggtgaagacaggcacccaacctcca
gggaagatggagtaccacctcatcccccactccttgcctggccacccagactgcaaaacc
atccggatcatctacagcatcccccccggcattcagggaccggaacacccgaatcctggg
aagagtttcagcgcccgaggcttcccacgacactgttaccttccggacagcgagaaaggg
agaaaagttctgaagctgctgctcgtggcctgggatcgccgcctcatttttgccattggc
acctccagcaccacaggcgagtcagacaccgtcatctggaatgaggtccaccacaagaca
gagtttggctctaatctcactggccatggctacccagatgccaattacctggataatgtg
ctggctgaactggctgcccagggcatctctgaggacagcactgcccaggagaaggactga

DBGET integrated database retrieval system