KEGG   Homo sapiens (human): 23221Help
Entry
23221             CDS       T01001                                 

Gene name
RHOBTB2, DBC2
Definition
(RefSeq) Rho related BTB domain containing 2
  KO
K07868  
Rho-related BTB domain-containing protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    23221 (RHOBTB2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Target recognizing subunit (BTB)
     23221 (RHOBTB2)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rho Family
   RhoBTB
    23221 (RHOBTB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p21.3
AA seq 727 aa AA seqDB search
MDSDMDYERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYR
VCQEVLERSRDVVDDVSVSLRLWDTFGDHHKDRRFAYGRSDVVVLCFSIANPNSLHHVKT
MWYPEIKHFCPRAPVILVGCQLDLRYADLEAVNRARRPLARPIKPNEILPPEKGREVAKE
LGIPYYETSVVAQFGIKDVFDNAIRAALISRRHLQFWKSHLRNVQRPLLQAPFLPPKPPP
PIIVVPDPPSSSEECPAHLLEDPLCADVILVLQERVRIFAHKIYLSTSSSKFYDLFLMDL
SEGELGGPSEPGGTHPEDHQGHSDQHHHHHHHHHGRDFLLRAASFDVCESVDEAGGSGPA
GLRASTSDGILRGNGTGYLPGRGRVLSSWSRAFVSIQEEMAEDPLTYKSRLMVVVKMDSS
IQPGPFRAVLKYLYTGELDENERDLMHIAHIAELLEVFDLRMMVANILNNEAFMNQEITK
AFHVRRTNRVKECLAKGTFSDVTFILDDGTISAHKPLLISSCDWMAAMFGGPFVESSTRE
VVFPYTSKSCMRAVLEYLYTGMFTSSPDLDDMKLIILANRLCLPHLVALTEQYTVTGLME
ATQMMVDIDGDVLVFLELAQFHCAYQLADWCLHHICTNYNNVCRKFPRDMKAMSPENQEY
FEKHRWPPVWYLKEEDHYQRARKEREKEDYLHLKRQPKRRWLFWNSPSSPSSSAASSSSP
SSSSAVV
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggattctgacatggattatgaaaggccaaacgtagagaccatcaagtgcgttgtggtg
ggggacaacgccgtgggtaagaccaggctcatctgtgcccgcgcttgcaatgccaccctc
acccagtaccagctgctggccacgcatgtgcccacagtatgggccatcgaccaatatcgt
gtgtgccaggaggtgctggaacgctcccgagacgtggtagatgatgtcagcgtctctctg
cgcctctgggacacctttggagaccaccacaaagaccgtcgctttgcttatgggagatct
gatgtggtggttctgtgcttctccattgccaaccccaattccctccaccatgtcaagacc
atgtggtacccagaaatcaagcacttctgcccccgagcacctgtcatcttggtgggctgc
cagttggacctgcgctacgctgacctggaggctgtcaacagggctaggcgacccttggct
aggcccatcaaacctaatgaaatcctgcccccagagaagggtcgggaggtggccaaggag
ctgggcatcccctactatgagaccagcgtggtggcccagttcggcatcaaggacgtcttt
gacaacgccatccgagctgcactcatctcccgccgccacctgcagttctggaagtcccac
ctccgcaatgtgcagcggcctctgctgcaggcacccttcctaccccccaagccaccgccc
ccgatcatcgtggtgcccgaccctccctccagcagcgaggagtgccccgcccacctcctg
gaggacccgctctgcgcggacgtcatcctggtgctgcaggagcgggtgcgcatctttgcc
cacaagatctacctctccacctcttcctccaagttctatgacctgttcctcatggacctg
agtgagggggagctggggggcccctcggagccagggggcacccacccagaggaccaccag
ggccactctgatcaacaccaccaccatcaccaccaccaccatgggcgagacttcctgctc
cgagcagccagctttgacgtgtgcgagagcgtggatgaggctgggggctccggtcctgct
ggcctccgtgcttccaccagcgacgggatcttacggggcaacggaacagggtacctaccg
ggcaggggtcgtgtgctgtcttcctggagccgagcttttgtgagcatccaggaagagatg
gcagaagatcctctcacctacaaatcccggctgatggtggtggtgaagatggacagttcc
atccagccggggcccttccgggctgtcctcaagtacctgtacacgggggagctagatgag
aacgagcgtgacctcatgcacattgcccacattgctgagctgctcgaggtctttgatctg
cgcatgatggtggccaacattctcaacaatgaggccttcatgaaccaggagatcaccaag
gccttccacgtccgccggaccaaccgggttaaggagtgcttggcaaaaggcaccttctca
gatgtgaccttcatcctggatgatggcaccatcagcgcccacaagcccctgttgatttcc
agctgtgactggatggctgccatgtttggggggccatttgtggagagctccacccgggag
gtggtgtttccctacacaagcaagagctgcatgcgggccgtgctggaatacctctacacc
ggcatgttcacctccagccccgacctggatgacatgaagctcatcattctagccaaccgc
ctctgcctgccacacctggttgccctcacagagcagtacacagtgaccgggctgatggaa
gcgacccagatgatggtggacatcgatggggacgtccttgtgttcctggaactggctcag
ttccactgtgcgtaccagctggccgactggtgtctccaccacatctgcaccaactacaac
aacgtgtgccgcaagttcccccgagacatgaaggccatgtccccagaaaaccaggagtat
ttcgagaagcatcggtggccacctgtgtggtacctgaaggaggaagatcattaccagcgg
gcacggaaggagcgtgagaaggaggactacctccacctcaagcggcagcccaaacggcgt
tggctcttctggaacagtccatcctccccgtcttcctcggcagcctcctcctcatcccca
tcttcctcctcggctgtggtctga

DBGET integrated database retrieval system