KEGG   Homo sapiens (human): 23221Help
Entry
23221             CDS       T01001                                 

Gene name
RHOBTB2, DBC2
Definition
Rho-related BTB domain containing 2
Orthology
K07868  
Rho-related BTB domain-containing protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p21.3
AA seq 749 aa AA seqDB search
MQAWRKGPDGPQKTSSDSMSRLMDSDMDYERPNVETIKCVVVGDNAVGKTRLICARACNA
TLTQYQLLATHVPTVWAIDQYRVCQEVLERSRDVVDDVSVSLRLWDTFGDHHKDRRFAYG
RSDVVVLCFSIANPNSLHHVKTMWYPEIKHFCPRAPVILVGCQLDLRYADLEAVNRARRP
LARPIKPNEILPPEKGREVAKELGIPYYETSVVAQFGIKDVFDNAIRAALISRRHLQFWK
SHLRNVQRPLLQAPFLPPKPPPPIIVVPDPPSSSEECPAHLLEDPLCADVILVLQERVRI
FAHKIYLSTSSSKFYDLFLMDLSEGELGGPSEPGGTHPEDHQGHSDQHHHHHHHHHGRDF
LLRAASFDVCESVDEAGGSGPAGLRASTSDGILRGNGTGYLPGRGRVLSSWSRAFVSIQE
EMAEDPLTYKSRLMVVVKMDSSIQPGPFRAVLKYLYTGELDENERDLMHIAHIAELLEVF
DLRMMVANILNNEAFMNQEITKAFHVRRTNRVKECLAKGTFSDVTFILDDGTISAHKPLL
ISSCDWMAAMFGGPFVESSTREVVFPYTSKSCMRAVLEYLYTGMFTSSPDLDDMKLIILA
NRLCLPHLVALTEQYTVTGLMEATQMMVDIDGDVLVFLELAQFHCAYQLADWCLHHICTN
YNNVCRKFPRDMKAMSPENQEYFEKHRWPPVWYLKEEDHYQRARKEREKEDYLHLKRQPK
RRWLFWNSPSSPSSSAASSSSPSSSSAVV
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcctggagaaaaggccccgatggcccccagaagacctcttcagacagcatgtcc
cgtttaatggattctgacatggattatgaaaggccaaacgtagagaccatcaagtgcgtt
gtggtgggggacaacgccgtgggtaagaccaggctcatctgtgcccgcgcttgcaatgcc
accctcacccagtaccagctgctggccacgcatgtgcccacagtatgggccatcgaccaa
tatcgtgtgtgccaggaggtgctggaacgctcccgagacgtggtagatgatgtcagcgtc
tctctgcgcctctgggacacctttggagaccaccacaaagaccgtcgctttgcttatggg
agatctgatgtggtggttctgtgcttctccattgccaaccccaattccctccaccatgtc
aagaccatgtggtacccagaaatcaagcacttctgcccccgagcacctgtcatcttggtg
ggctgccagttggacctgcgctacgctgacctggaggctgtcaacagggctaggcgaccc
ttggctaggcccatcaaacctaatgaaatcctgcccccagagaagggtcgggaggtggcc
aaggagctgggcatcccctactatgagaccagcgtggtggcccagttcggcatcaaggac
gtctttgacaacgccatccgagctgcactcatctcccgccgccacctgcagttctggaag
tcccacctccgcaatgtgcagcggcctctgctgcaggcacccttcctaccccccaagcca
ccgcccccgatcatcgtggtgcccgaccctccctccagcagcgaggagtgccccgcccac
ctcctggaggacccgctctgcgcggacgtcatcctggtgctgcaggagcgggtgcgcatc
tttgcccacaagatctacctctccacctcttcctccaagttctatgacctgttcctcatg
gacctgagtgagggggagctggggggcccctcggagccagggggcacccacccagaggac
caccagggccactctgatcaacaccaccaccatcaccaccaccaccatgggcgagacttc
ctgctccgagcagccagctttgacgtgtgcgagagcgtggatgaggctgggggctccggt
cctgctggcctccgtgcttccaccagcgacgggatcttacggggcaacggaacagggtac
ctaccgggcaggggtcgtgtgctgtcttcctggagccgagcttttgtgagcatccaggaa
gagatggcagaagatcctctcacctacaaatcccggctgatggtggtggtgaagatggac
agttccatccagccggggcccttccgggctgtcctcaagtacctgtacacgggggagcta
gatgagaacgagcgtgacctcatgcacattgcccacattgctgagctgctcgaggtcttt
gatctgcgcatgatggtggccaacattctcaacaatgaggccttcatgaaccaggagatc
accaaggccttccacgtccgccggaccaaccgggttaaggagtgcttggcaaaaggcacc
ttctcagatgtgaccttcatcctggatgatggcaccatcagcgcccacaagcccctgttg
atttccagctgtgactggatggctgccatgtttggggggccatttgtggagagctccacc
cgggaggtggtgtttccctacacaagcaagagctgcatgcgggccgtgctggaatacctc
tacaccggcatgttcacctccagccccgacctggatgacatgaagctcatcattctagcc
aaccgcctctgcctgccacacctggttgccctcacagagcagtacacagtgaccgggctg
atggaagcgacccagatgatggtggacatcgatggggacgtccttgtgttcctggaactg
gctcagttccactgtgcgtaccagctggccgactggtgtctccaccacatctgcaccaac
tacaacaacgtgtgccgcaagttcccccgagacatgaaggccatgtccccagaaaaccag
gagtatttcgagaagcatcggtggccacctgtgtggtacctgaaggaggaagatcattac
cagcgggcacggaaggagcgtgagaaggaggactacctccacctcaagcggcagcccaaa
cggcgttggctcttctggaacagtccatcctccccgtcttcctcggcagcctcctcctca
tccccatcttcctcctcggctgtggtctga

DBGET integrated database retrieval system