KEGG   Homo sapiens (human): 2323Help
Entry
2323              CDS       T01001                                 

Gene name
FLT3LG, FL, FLG3L, FLT3L
Definition
(RefSeq) fms related tyrosine kinase 3 ligand
  KO
K05454  
fms-related tyrosine kinase 3 ligand
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Hematopoietic cell lineage
Pathways in cancer
Network
N00217  
FLT3LG-FLT3-RAS-ERK signaling pathway
N00218  
FLT3LG-FLT3-RAS-PI3K signaling pathway
N00219  
FLT3LG-FLT3-STAT5 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2323 (FLT3LG)
   04010 MAPK signaling pathway
    2323 (FLT3LG)
   04151 PI3K-Akt signaling pathway
    2323 (FLT3LG)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2323 (FLT3LG)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    2323 (FLT3LG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2323 (FLT3LG)
Cytokines [BR:hsa04052]
 PDGF family
  4-Helix bundle growth factors
   2323 (FLT3LG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P49771(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.33
AA seq 235 aa AA seqDB search
MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTV
ASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCL
RFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPT
APQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgacagtgctggcgccagcctggagcccaacaacctatctcctcctgctgctgctgctg
agctcgggactcagtgggacccaggactgctccttccaacacagccccatctcctccgac
ttcgctgtcaaaatccgtgagctgtctgactacctgcttcaagattacccagtcaccgtg
gcctccaacctgcaggacgaggagctctgcgggggcctctggcggctggtcctggcacag
cgctggatggagcggctcaagactgtcgctgggtccaagatgcaaggcttgctggagcgc
gtgaacacggagatacactttgtcaccaaatgtgcctttcagcccccccccagctgtctt
cgcttcgtccagaccaacatctcccgcctcctgcaggagacctccgagcagctggtggcg
ctgaagccctggatcactcgccagaacttctcccggtgcctggagctgcagtgtcagccc
gactcctcaaccctgccacccccatggagtccccggcccctggaggccacagccccgaca
gccccgcagccccctctgctcctcctactgctgctgcccgtgggcctcctgctgctggcc
gctgcctggtgcctgcactggcagaggacgcggcggaggacaccccgccctggggagcag
gtgccccccgtccccagtccccaggacctgctgcttgtggagcactga

DBGET integrated database retrieval system