KEGG   Homo sapiens (human): 2323Help
Entry
2323              CDS       T01001                                 

Gene name
FLT3LG, FL, FLT3L
Definition
fms-related tyrosine kinase 3 ligand
Orthology
K05454  
fms-related tyrosine kinase 3 ligand
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Hematopoietic cell lineage
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2323 (FLT3LG)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    2323 (FLT3LG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2323 (FLT3LG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.3
AA seq 235 aa AA seqDB search
MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTV
ASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCL
RFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPT
APQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgacagtgctggcgccagcctggagcccaacaacctatctcctcctgctgctgctgctg
agctcgggactcagtgggacccaggactgctccttccaacacagccccatctcctccgac
ttcgctgtcaaaatccgtgagctgtctgactacctgcttcaagattacccagtcaccgtg
gcctccaacctgcaggacgaggagctctgcgggggcctctggcggctggtcctggcacag
cgctggatggagcggctcaagactgtcgctgggtccaagatgcaaggcttgctggagcgc
gtgaacacggagatacactttgtcaccaaatgtgcctttcagcccccccccagctgtctt
cgcttcgtccagaccaacatctcccgcctcctgcaggagacctccgagcagctggtggcg
ctgaagccctggatcactcgccagaacttctcccggtgcctggagctgcagtgtcagccc
gactcctcaaccctgccacccccatggagtccccggcccctggaggccacagccccgaca
gccccgcagccccctctgctcctcctactgctgctgcccgtgggcctcctgctgctggcc
gctgcctggtgcctgcactggcagaggacgcggcggaggacaccccgccctggggagcag
gtgccccccgtccccagtccccaggacctgctgcttgtggagcactga

DBGET integrated database retrieval system