KEGG   Homo sapiens (human): 23230Help
Entry
23230             CDS       T01001                                 

Gene name
VPS13A, CHAC, CHOREIN
Definition
(RefSeq) vacuolar protein sorting 13 homolog A (S. cerevisiae)
  KO
K19525  
vacuolar protein sorting-associated protein 13A/C
Organism
hsa  Homo sapiens (human)
Disease
H00832  
Core neuroacanthocytosis syndromes
H01432  
Choreoacanthocytosis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q21
AA seq 3174 aa AA seqDB search
MVFESVVVDVLNRFLGDYVVDLDTSQLSLGIWKGAVALKNLQIKENALSQLDVPFKVKVG
HIGNLKLIIPWKNLYTQPVEAVLEEIYLLIVPSSRIKYDPLKEEKQLMEAKQQELKRIEE
AKQKVVDQEQHLPEKQDTFAEKLVTQIIKNLQVKISSIHIRYEDDITNRDKPLSFGISLQ
NLSMQTTDQYWVPCLHDETEKLVRKLIRLDNLFAYWNVKSQMFYLSDYDNSLDDLKNGIV
NENIVPEGYDFVFRPISANAKLVMNRRSDFDFSAPKINLEIELHNIAIEFNKPQYFSIME
LLESVDMMAQNLPYRKFKPDVPLHHHAREWWAYAIHGVLEVNVCPRLWMWSWKHIRKHRQ
KVKQYKELYKKKLTSKKPPGELLVSLEELEKTLDVFNITIARQTAEVEVKKAGYKIYKEG
VKDPEDNKGWFSWLWSWSEQNTNEQQPDVQPETLEEMLTPEEKALLYEAIGYSETAVDPT
LLKTFEALKFFVHLKSMSIVLRENHQKPELVDIVIEEFSTLIVQRPGAQAIKFETKIDSF
HITGLPDNSEKPRLLSSLDDAMSLFQITFEINPLDETVSQRCIIEAEPLEIIYDARTVNS
IVEFFRPPKEVHLAQLTAATLTKLEEFRSKTATGLLYIIETQKVLDLKINLKASYIIVPQ
DGIFSPTSNLLLLDLGHLKVTSKSRSELPDVKQGEANLKEIMDRAYDSFDIQLTSVQLLY
SRVGDNWREARKLSVSTQHILVPMHFNLELSKAMVFMDVRMPKFKIYGKLPLISLRISDK
KLQGIMELIESIPKPEPVTEVSAPVKSFQIQTSTSLGTSQISQKIIPLLELPSVSEDDSE
EEFFDAPCSPLEEPLQFPTGVKSIRTRKLQKQDCSVNMTTFKIRFEVPKVLIEFYHLVGD
CELSVVEILVLGLGAEIEIRTYDLKANAFLKEFCLKCPEYLDENKKPVYLVTTLDNTMED
LLTLEYVKAEKNVPDLKSTYNNVLQLIKVNFSSLDIHLHTEALLNTINYLHNILPQSEEK
SAPVSTTETEDKGDVIKKLALKLSTNEDIITLQILAELSCLQIFIQDQKCNISEIKIEGL
DSEMIMRPSETEINAKLRNIIVLDSDITAIYKKAVYITGKEVFSFKMVSYMDATAGSAYT
DMNVVDIQVNLIVGCIEVVFVTKFLYSILAFIDNFQAAKQALAEATVQAAGMAATGVKEL
AQRSSRMALDINIKAPVVVIPQSPVSENVFVADFGLITMTNTFHMITESQSSPPPVIDLI
TIKLSEMRLYRSRFINDAYQEVLDLLLPLNLEVVVERNLCWEWYQEVPCFNVNAQLKPME
FILSQEDITTIFKTLHGNIWYEKDGSASPAVTKDQYSATSGVTTNASHHSGGATVVTAAV
VEVHSRALLVKTTLNISFKTDDLTMVLYSPGPKQASFTDVRDPSLKLAEFKLENIISTLK
MYTDGSTFSSFSLKNCILDDKRPHVKKATPRMIGLTVGFDKKDMMDIKYRKVRDGCVTDA
VFQEMYICASVEFLQTVANVFLEAYTTGTAVETSVQTWTAKEEVPTQESVKWEINVIIKN
PEIVFVADMTKNDAPALVITTQCEICYKGNLENSTMTAAIKDLQVRACPFLPVKRKGKIT
TVLQPCDLFYQTTQKGTDPQVIDMSVKSLTLKVSPVIINTMITITSALYTTKETIPEETA
SSTAHLWEKKDTKTLKMWFLEESNETEKIAPTTELVPKGEMIKMNIDSIFIVLEAGIGHR
TVPMLLAKSRFSGEGKNWSSLINLHCQLELEVHYYNEMFGVWEPLLEPLEIDQTEDFRPW
NLGIKMKKKAKMAIVESDPEEENYKVPEYKTVISFHSKDQLNITLSKCGLVMLNNLVKAF
TEAATGSSADFVKDLAPFMILNSLGLTISVSPSDSFSVLNIPMAKSYVLKNGESLSMDYI
RTKDNDHFNAMTSLSSKLFFILLTPVNHSTADKIPLTKVGRRLYTVRHRESGVERSIVCQ
IDTVEGSKKVTIRSPVQIRNHFSVPLSVYEGDTLLGTASPENEFNIPLGSYRSFIFLKPE
DENYQMCEGIDFEEIIKNDGALLKKKCRSKNPSKESFLINIVPEKDNLTSLSVYSEDGWD
LPYIMHLWPPILLRNLLPYKIAYYIEGIENSVFTLSEGHSAQICTAQLGKARLHLKLLDY
LNHDWKSEYHIKPNQQDISFVSFTCVTEMEKTDLDIAVHMTYNTGQTVVAFHSPYWMVNK
TGRMLQYKADGIHRKHPPNYKKPVLFSFQPNHFFNNNKVQLMVTDSELSNQFSIDTVGSH
GAVKCKGLKMDYQVGVTIDLSSFNITRIVTFTPFYMIKNKSKYHISVAEEGNDKWLSLDL
EQCIPFWPEYASSKLLIQVERSEDPPKRIYFNKQENCILLRLDNELGGIIAEVNLAEHST
VITFLDYHDGAATFLLINHTKNELVQYNQSSLSEIEDSLPPGKAVFYTWADPVGSRRLKW
RCRKSHGEVTQKDDMMMPIDLGEKTIYLVSFFEGLQRIILFTEDPRVFKVTYESEKAELA
EQEIAVALQDVGISLVNNYTKQEVAYIGITSSDVVWETKPKKKARWKPMSVKHTEKLERE
FKEYTESSPSEDKVIQLDTNVPVRLTPTGHNMKILQPHVIALRRNYLPALKVEYNTSAHQ
SSFRIQIYRIQIQNQIHGAVFPFVFYPVKPPKSVTMDSAPKPFTDVSIVMRSAGHSQISR
IKYFKVLIQEMDLRLDLGFIYALTDLMTEAEVTENTEVELFHKDIEAFKEEYKTASLVDQ
SQVSLYEYFHISPIKLHLSVSLSSGREEAKDSKQNGGLIPVHSLNLLLKSIGATLTDVQD
VVFKLAFFELNYQFHTTSDLQSEVIRHYSKQAIKQMYVLILGLDVLGNPFGLIREFSEGV
EAFFYEPYQGAIQGPEEFVEGMALGLKALVGGAVGGLAGAASKITGAMAKGVAAMTMDED
YQQKRREAMNKQPAGFREGITRGGKGLVSGFVSGITGIVTKPIKGAQKGGAAGFFKGVGK
GLVGAVARPTGGIIDMASSTFQGIKRATETSEVESLRPPRFFNEDGVIRPYRLRDGTGNQ
MLQVMENGRFAKYKYFTHVMINKTDMLMITRRGVLFVTKGTFGQLTCEWQYSFDEFTKEP
FIVHGRRLRIEAKERVKSVFHAREFGKIINFKTPEDARWILTKLQEAREPSPSL
NT seq 9525 nt NT seq  +upstreamnt  +downstreamnt
atggttttcgagtcggtggtcgtggacgtgttgaaccggttcttgggggactatgtggtg
gacttggacacgtcccagctctctctgggcatctggaaaggagctgtggccctcaagaat
cttcaaattaaagaaaatgccctgagtcaactggatgtaccatttaaagttaaagttggt
cacataggtaatcttaaacttataattccatggaaaaacctttatactcaacctgttgaa
gccgtattggaagaaatttatttacttatagtgccttcttctagaataaaatatgatcct
ttaaaagaagagaaacaactcatggaagcaaagcaacaggaactgaaaagaatagaagaa
gcaaaacaaaaagtagttgatcaagaacaacatctgccggaaaaacaggacacttttgca
gaaaaattagttacacagatcataaaaaatcttcaggtgaaaatttccagtatccatatt
cgttatgaagatgatatcacaaatcgggacaaaccgctgtcatttggtatttcccttcaa
aatctgagcatgcagacaactgatcaatactgggttccatgtttacatgatgaaactgag
aaactggttcgtaagttaatccgattggataacctgtttgcctattggaatgtgaagtct
cagatgttttatcttagtgattatgataactccttggacgacttgaagaatggcattgtc
aatgaaaatattgttccagaaggttatgattttgtatttcgtcccatatctgctaatgcc
aaacttgtgatgaatcgccgatctgattttgacttttctgcccccaaaataaacttggaa
attgagttacataacatagcaattgaatttaataaaccacagtatttcagtattatggag
cttcttgaatcagttgatatgatggcacaaaatctgccatataggaagttcaaacctgat
gtgcctcttcaccaccatgccagagaatggtgggcttatgctatacatggcgttcttgaa
gtaaatgtttgccccaggttatggatgtggtcatggaagcatattagaaaacataggcaa
aaagtgaagcaatataaagaactgtataaaaaaaagttaacaagtaagaagccacctggt
gaacttctcgtgtctttggaggagttggaaaaaaccttggatgtctttaatataactata
gctagacagacggcagaagttgaggtaaagaaagctggatacaaaatttacaaagaagga
gtaaaagatccagaggataataaagggtggtttagctggctatggtcttggtcagaacaa
aatactaatgaacagcaaccagatgttcaacctgaaactcttgaagaaatgttgacacct
gaagaaaaagctttactctatgaagcaattggctatagtgaaacagcagttgatccaact
ttactaaaaacatttgaagccttgaagttttttgtccacttgaaaagtatgtctattgtt
ctaagagaaaatcatcaaaaacctgagctggtagatattgtaatagaagaatttagcacc
ttaattgtgcaaagaccaggagcacaagcaataaaatttgaaactaaaatagattcattt
catattactggcttaccagataattcagaaaaaccccgcctcctgtcttcattggatgat
gcaatgtcacttttccaaattacatttgagataaatccattagatgaaactgtttctcag
aggtgtatcatagaagctgaacctttagaaatcatatatgatgcaaggacagtgaatagt
atagtggaattcttcagacctccaaaagaggtacatctagcacagctcactgcagcaact
ttgacaaaactggaagaatttcgcagtaagacagcaacaggtctactgtatattattgaa
acacagaaagttcttgatctcaaaattaatttgaaggcttcatatattattgtcccacaa
gatggaatttttagtcctacatcaaatctgcttcttttggaccttggtcatctaaaggtg
acgagtaaaagtcgttctgaattaccagatgtgaaacaaggtgaggccaatcttaaagag
ataatggatagagcttatgattcatttgatattcaacttacaagtgtacagctgctttac
agtagagttggtgataattggagagaagcacgaaaactcagtgtatctacccagcatatt
ttggtacccatgcacttcaatttggaactgtctaaggccatggttttcatggatgtaagg
atgcccaaattcaagatttatggaaagttacctcttatttctttacgaatctcagataaa
aaactacaagggattatggaattgattgaaagcattccaaaacctgaaccagtaactgaa
gtatctgcccctgtcaaatcattccagattcaaacatctacttctttgggaacatcacag
atttcacagaaaataattcctctcttggaacttccatctgtttctgaagatgattcagag
gaggaattttttgatgcaccatgtagtcccttggaagaacctcttcagtttccaactgga
gttaaaagtattcgaaccagaaagttacaaaagcaggattgttcagtaaatatgactaca
tttaaaataagatttgaagtaccaaaggttttgatcgagttttatcaccttgttggagat
tgtgaactatctgtggtagaaattcttgttttaggattgggtgcagaaattgagattaga
acatacgatttgaaagcaaatgcctttttgaaagagttctgcttaaaatgcccagaatac
ttggatgaaaacaagaaaccagtttatttggttacaaccctggataacacaatggaagac
ctgttaacgctggaatatgtaaaggctgaaaagaatgtacccgacttgaaaagtacctat
aacaatgttttacaattgattaaggtaaatttttcctctttggatattcatttacacact
gaagcacttctgaatacaataaattatcttcataatatccttccgcaatcagaggaaaaa
tcagccccagtgtccactacagagactgaagacaaaggagatgtcattaaaaaattagct
ttaaaactatccacaaatgaagatatcattactttgcagattttagcagaattatcgtgt
ttacagatctttattcaagatcagaaatgtaacatttctgaaattaagattgaagggctt
gattctgagatgattatgaggccttcagaaactgaaataaacgcaaagctaaggaatata
attgttttagattctgatataacagctatatacaaaaaggctgtttatatcactggaaaa
gaagttttcagcttcaaaatggtttcttacatggatgcaactgctggttctgcatacaca
gatatgaatgtggttgacattcaggttaatttaatagttggttgcattgaagtagttttt
gtcacgaaatttctatattctatattggcttttatagataattttcaggcagctaaacaa
gccttggctgaggcaactgttcaggcagctggaatggctgctactggtgtaaaagaactc
gcacaaaggagttccagaatggcactggatattaacatcaaagccccagttgtggtcatc
ccgcagtctccagtttctgaaaatgtttttgttgctgattttggactaattacaatgaca
aatacctttcatatgataacagagagccagagctctcccccacctgttattgatttgata
acaataaagctgagtgaaatgcgactatacagatctcgatttattaatgatgcataccag
gaagtactggatctactcctgccattaaatcttgaggttgtggttgaacgaaatttatgc
tgggagtggtaccaggaagttccttgttttaatgtaaatgctcagctgaaaccaatggag
ttcattcttagtcaagaagatataacaactatttttaaaacattgcatggcaatatatgg
tatgaaaaagatggtagtgcctcacctgctgtaacaaaagaccaatacagtgccactagt
ggagttactactaatgcttcacaccattcaggaggagcaactgtggtgacagctgctgtg
gtagaagtacattcacgtgccttactagttaagacaacactaaacataagcttcaaaact
gatgatctcaccatggtgctgtatagtccaggtcctaaacaggcttcctttacagatgtt
cgtgatccttctctgaaacttgctgaatttaaattggagaatattataagtactttaaaa
atgtatacagatggctcaacattttcttccttctcattaaaaaactgtattttagatgat
aaaagacctcatgtcaagaaagcaactcctcgaatgataggactgacagttggttttgac
aaaaaagacatgatggatataaagtacaggaaagtcagagatggttgtgtgactgatgcg
gtctttcaagaaatgtatatttgtgcaagcgtagaatttctgcagactgttgcaaatgtc
tttcttgaggcctacaccacaggcactgctgtagaaaccagtgtgcaaacatggactgct
aaggaagaagtacctacacaggaatcagtgaagtgggaaattaatgttattattaaaaat
cctgaaattgtgtttgtagctgacatgacaaaaaatgatgctcctgctttagtcattaca
acacaatgtgaaatttgctataaaggtaaccttgaaaatagtacaatgactgctgccatt
aaagatctccaagtgagagcctgcccgtttcttccagtcaagagaaaaggcaaaatcact
actgttttgcagccctgtgacttgttttatcaaactactcagaaaggtacagatccacaa
gtgatcgatatgtcagtaaaatccctgacactaaaggtttcaccagttattataaatact
atgattaccataacttcagcactgtatacaactaaggaaaccatcccagaagaaacggct
tcttctactgcacatttatgggaaaagaaggatacaaagactttaaaaatgtggtttctt
gaagaatcaaatgaaactgaaaaaatagctcccacaactgaattggtacccaaaggcgag
atgataaaaatgaacattgattctatttttatagttcttgaggctggaattggtcataga
acagtacctatgcttctggcaaagtcacgtttttcaggggaaggcaaaaactggagttcc
ctaataaatctgcactgtcagcttgagctagaagtgcattattataatgaaatgtttggt
gtatgggagcctttgcttgaacccttagaaattgatcagactgaggattttagaccatgg
aatcttggtatcaagatgaaaaagaaagcaaaaatggccattgttgagtcagatcctgaa
gaagaaaactacaaagtgccagaatataaaactgtcatcagtttccattcaaaagaccaa
ttaaacattacattatccaaatgtggtcttgtaatgttaaacaatttagtcaaggcattt
acagaagctgccactggatcttcagctgacttcgtaaaggatctagcaccatttatgatt
ttaaattcccttggacttactatttctgtttcgccaagtgattcttttagtgtactcaac
attcctatggcaaaatcatatgtattgaaaaatggagaaagtttaagtatggattatatc
cgaaccaaggacaatgatcatttcaatgcaatgaccagcctaagcagcaaactcttcttc
attcttcttacacctgttaaccattctactgctgataagattcctttaacaaaagtggga
cgacgtctgtacactgtaagacacagagagtctggcgttgaaagatctattgtttgtcaa
attgatacagtagaaggaagtaagaaggtcacaattcgctccccagtgcagataagaaat
catttttcagtcccactgtctgtttacgaaggggataccttattgggaactgcctcacct
gaaaatgaattcaacataccattaggatcttaccgatcattcatttttctgaagccagaa
gatgagaactatcaaatgtgtgaaggaattgactttgaagagattataaaaaatgatggt
gctcttctaaagaagaaatgtagatctaaaaacccttctaaggaatcatttctcattaat
attgttccagaaaaagataatttaacatctctatcagtgtattcagaagatggttgggat
ttaccatacataatgcatttgtggccacctatcctgctccgaaatcttcttccttacaaa
attgcttattatatagagggaattgaaaattcggtttttactctaagtgaaggacattca
gcccagatttgtactgcacagttgggtaaagccaggctacatttaaaattacttgactat
ctcaatcacgattggaaaagtgaatatcacataaagcctaatcagcaagacattagtttt
gtcagttttacttgtgttacagaaatggaaaagactgatttagatattgctgtccatatg
acttacaatactggtcagacagttgtggcatttcatagtccttattggatggtcaataaa
actggccgcatgttacagtacaaagcagacggaattcatcgaaagcatccacctaattat
aaaaagccagttctcttttcttttcagccaaatcacttttttaataacaataaggttcaa
cttatggtaactgatagtgagttgtccaatcagttttcaattgatactgttggtagtcat
ggagctgttaaatgtaaaggcctgaaaatggactatcaagttggtgtcactatagacctg
agcagttttaacattactagaattgtgacatttacccctttttatatgattaaaaacaaa
agcaaataccatatatcagtggctgaagaaggaaatgataaatggctctctcttgatttg
gagcagtgtatccccttttggcctgagtatgcttctagtaaacttcttattcaagtcgaa
aggagtgaagatcctcccaaaaggatatattttaacaagcaggaaaattgtattctattg
cgtctagataacgagcttggaggtattatagcagaagtgaatttggccgagcattctaca
gttattacatttttagattatcatgatggagcagctacattcctcttaataaatcacaca
aagaatgaacttgttcaatacaatcaaagttctctcagtgaaatagaagattccctccct
cctggtaaagccgtgttttatacatgggctgatccggtgggctctagaaggctgaagtgg
agatgtagaaaaagccatggtgaagtaacacagaaggatgatatgatgatgcctatagat
ttgggggaaaagacaatatatttagtttcattctttgaaggtttacaacgcattatttta
ttcactgaagatccaagggtatttaaagtaacatatgaaagtgagaaagcagagttagca
gagcaagaaattgcagtggcattacaagatgttggaatttctcttgtcaacaattacacg
aagcaagaagtagcctatataggcattacaagttctgatgtggtttgggaaacaaagccc
aagaagaaggcaagatggaagccaatgagtgtaaagcacactgagaagttagagagagaa
tttaaggaatatactgaatcttctccttcagaagataaggttattcagttggacactaat
gttccggttcgcctaacccctactggtcataacatgaaaattctgcagccgcatgtaata
gctctacgaagaaattatcttccagcattaaaagtggaatataacacatctgcacatcaa
tcatcatttagaattcagatttacagaatacagatccaaaatcagatacatggtgctgta
tttccctttgtgttttatcctgttaaacctccaaagtcggtcaccatggattcagcacca
aagccctttacagatgtcagtattgtcatgagatctgcaggacattcccagatatcacgt
attaagtatttcaaagtattgattcaagaaatggatctcaggttagatcttgggtttatc
tatgctttaacagaccttatgacagaagctgaggtgactgaaaatacagaggttgagctt
tttcataaagatatagaagctttcaaagaagaatataaaacagcctcattagtagatcaa
tcacaagtcagcctctatgaatattttcatatatctcctatcaagttacatttaagtgtt
tcactgagttccggcagagaagaagctaaagattcaaaacaaaatggaggactgattcca
gttcattctttaaatcttttgctgaagagtattggtgccacactgacagatgtacaagat
gtagtttttaagcttgcattttttgaactcaactatcagttccatacaacatccgatcta
cagtctgaagtcataagacactattcaaaacaggccattaagcagatgtatgtactcatt
cttggacttgatgttttgggaaatccatttggcttaattagagaattttctgaaggtgta
gaagcatttttttatgaaccttaccagggagccatccagggtcctgaagagtttgtggaa
ggaatggcactaggacttaaggcactagttggtggagctgttggtggattggctggtgct
gcctccaaaatcaccggtgctatggctaagggggtagcagctatgaccatggatgaagac
taccaacagaagagaagagaagccatgaataagcaaccagctggttttagagaaggcatc
actcgtggaggaaaaggcttagtttctggatttgttagtggcataacaggaattgttaca
aaaccaatcaaaggagctcaaaaaggaggagcagctggtttctttaaaggtgttgggaaa
ggtttagtaggagcggtagcaaggccaactggaggcatcatagacatggctagcagtaca
tttcagggaataaaaagagctacagagacttctgaagtggagagtctgcgacctcctcgg
ttcttcaatgaagatggagttatcagaccgtacaggttgagggatgggactggaaatcaa
atgttacaggtcatggaaaatggaagatttgcaaaatacaaatattttacccatgtcatg
atcaataagacagatatgctaatgataaccagacgtggtgtattgtttgtaacaaaggga
acatttggacaactcacgtgtgagtggcagtatagttttgatgaatttaccaaagagcca
ttcattgttcatgggagaagattgcgcattgaagcaaaggaacgagtgaagtctgtattt
catgccagagagtttggaaaaataattaacttcaagaccccagaggatgccaggtggatc
ctcacaaagctacaagaagcaagagaaccttctccgagcctctga

DBGET integrated database retrieval system