KEGG   Homo sapiens (human): 23236Help
Entry
23236             CDS       T01001                                 

Gene name
PLCB1, EIEE12, PI-PLC, PLC-154, PLC-I, PLC-beta-1, PLC154, PLCB1A, PLCB1B
Definition
(RefSeq) phospholipase C beta 1
  KO
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Chemokine signaling pathway
Phosphatidylinositol signaling system
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Apelin signaling pathway
Gap junction
Platelet activation
NOD-like receptor signaling pathway
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Glucagon signaling pathway
Renin secretion
Aldosterone synthesis and secretion
Relaxin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Alzheimer's disease
Huntington's disease
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Amoebiasis
Pathways in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Disease
H00606  
Early infantile epileptic encephalopathy
H01815  
Malignant migrating partial seizures in infancy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    23236 (PLCB1)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    23236 (PLCB1)
   04310 Wnt signaling pathway
    23236 (PLCB1)
   04371 Apelin signaling pathway
    23236 (PLCB1)
   04020 Calcium signaling pathway
    23236 (PLCB1)
   04070 Phosphatidylinositol signaling system
    23236 (PLCB1)
   04072 Phospholipase D signaling pathway
    23236 (PLCB1)
   04071 Sphingolipid signaling pathway
    23236 (PLCB1)
   04022 cGMP - PKG signaling pathway
    23236 (PLCB1)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    23236 (PLCB1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    23236 (PLCB1)
   04621 NOD-like receptor signaling pathway
    23236 (PLCB1)
   04062 Chemokine signaling pathway
    23236 (PLCB1)
  Endocrine system
   04911 Insulin secretion
    23236 (PLCB1)
   04922 Glucagon signaling pathway
    23236 (PLCB1)
   04912 GnRH signaling pathway
    23236 (PLCB1)
   04915 Estrogen signaling pathway
    23236 (PLCB1)
   04921 Oxytocin signaling pathway
    23236 (PLCB1)
   04926 Relaxin signaling pathway
    23236 (PLCB1)
   04918 Thyroid hormone synthesis
    23236 (PLCB1)
   04919 Thyroid hormone signaling pathway
    23236 (PLCB1)
   04916 Melanogenesis
    23236 (PLCB1)
   04924 Renin secretion
    23236 (PLCB1)
   04925 Aldosterone synthesis and secretion
    23236 (PLCB1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    23236 (PLCB1)
   04270 Vascular smooth muscle contraction
    23236 (PLCB1)
  Digestive system
   04970 Salivary secretion
    23236 (PLCB1)
   04971 Gastric acid secretion
    23236 (PLCB1)
   04972 Pancreatic secretion
    23236 (PLCB1)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    23236 (PLCB1)
  Nervous system
   04724 Glutamatergic synapse
    23236 (PLCB1)
   04725 Cholinergic synapse
    23236 (PLCB1)
   04728 Dopaminergic synapse
    23236 (PLCB1)
   04726 Serotonergic synapse
    23236 (PLCB1)
   04720 Long-term potentiation
    23236 (PLCB1)
   04730 Long-term depression
    23236 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    23236 (PLCB1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    23236 (PLCB1)
  Environmental adaptation
   04713 Circadian entrainment
    23236 (PLCB1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    23236 (PLCB1)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    23236 (PLCB1)
   05016 Huntington's disease
    23236 (PLCB1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    23236 (PLCB1)
  Infectious diseases
   05146 Amoebiasis
    23236 (PLCB1)
   05142 Chagas disease (American trypanosomiasis)
    23236 (PLCB1)
   05143 African trypanosomiasis
    23236 (PLCB1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     23236 (PLCB1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    23236 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    23236 (PLCB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9NQ66(Tbio)
UniProt: 
Position
20p12.3
AA seq 1216 aa AA seqDB search
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGRHAKAPKDPKLRELLDVGNIGRLEQRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLARKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTYSDSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTMDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPTLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSEAPSEARTTPAENGVNHTTTLTPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKSAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSS
EELGGDIPGKEFDTPL
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atggccggggctcaacccggagtgcacgccttgcaactcaagcccgtgtgcgtgtccgac
agcctcaagaagggcaccaaattcgtcaagtgggatgatgactcaactattgttactcca
attattttgaggactgaccctcagggatttttcttttactggacagatcaaaacaaggag
acagagctactggatctcagccttgtcaaagatgccagatgtgggagacacgccaaagct
cccaaggaccccaaattacgtgaacttttggatgtggggaacatcgggcgcctggagcag
cgcatgatcacagtggtgtatgggcctgacctcgtgaacatctcccatttgaatctcgtg
gctttccaagaagaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaac
ctgctggcccaaaacatgtccagggatgcatttctggaaaaagcctatactaaacttaag
ctgcaagtcactccagaagggcgtattcctctcaaaaacatatatcgcttgttttcagca
gatcggaagcgagttgaaactgctttagaggcttgtagtcttccatcttcaaggaatgat
tcaatacctcaagaagatttcactccagaagtgtacagagttttcctcaacaacctttgc
cctcgacctgaaattgataacatcttttcagaatttggtgcaaaaagcaaaccatatctt
accgttgatcagatgatggattttatcaaccttaagcagcgagatcctcggcttaatgaa
atactttatccacctctaaaacaagagcaagtccaagtattgattgagaagtatgaaccc
aacaacagcctcgccagaaaaggacaaatatcagtggatgggttcatgcgctatctgagt
ggagaagaaaacggagtcgtttcacctgagaaactggatttgaatgaagacatgtctcag
cccctttctcactatttcattaattcctcgcacaacacctacctcacagctggccaactg
gctggaaactcctctgttgagatgtatcgccaagtgctcctgtctggttgtcgctgtgtg
gagctggactgctggaagggacggactgcagaagaggaacctgtcatcacccatggcttc
accatgacaactgaaatatctttcaaggaagtgatagaagcaattgcggagtgtgcattt
aagacttcaccttttccaattctcctttcgtttgagaaccatgtggattccccaaagcag
caagccaagatggcggagtactgccgactgatctttggggatgcccttctcatggagccc
ctggaaaaatatccactggaatctggagttcctcttccaagccctatggatttaatgtat
aaaattttggtgaaaaataagaagaaatcacacaagtcatcagaaggaagcggcaaaaag
aagctctcagaacaagcctccaacacctacagtgactcctccagcatgttcgagccctca
tccccaggagccggagaagctgatacggaaagtgacgacgacgatgatgatgatgactgt
aaaaaatcttcaatggatgaggggactgctggaagtgaggctatggccacagaagaaatg
tctaatctggtgaactatattcagccagtcaagtttgagtcatttgaaatttcaaaaaaa
agaaataaaagttttgaaatgtcttccttcgtggaaaccaaaggacttgaacaactcacc
aagtctccagtggaatttgtagaatataacaaaatgcagcttagcaggatatatccaaaa
ggaacacgtgtggattcatccaactatatgcctcagctcttctggaatgcaggttgtcag
atggtggcacttaatttccagacaatggacctggctatgcaaataaatatggggatgtat
gaatacaacgggaagagtggctacagattgaagccagagttcatgaggaggcctgacaag
cattttgatccatttactgaaggcatcgtagatgggatagtggcaaacactttgtctgtt
aagattatttcaggtcagtttctttctgataagaaagttgggacttacgtggaagtagat
atgtttggtttgcctgtggatacaaggaggaaggcatttaagaccaaaacatcccaagga
aatgctgtgaatcctgtctgggaagaagaacctattgtgttcaaaaaggtggttcttcct
actctggcctgtttgagaatagcagtttatgaagaaggaggtaaattcattggccaccgt
atcttgccagtgcaagccattcggccaggctatcactatatctgtctaaggaatgaaagg
aaccagcctctgacgctgcctgctgtctttgtctacatagaagtgaaagactatgtgcca
gacacatatgcagatgtcatcgaagctttatcaaacccaatccgatatgtgaacctgatg
gaacagagagctaagcaattggctgctttgacactggaagatgaagaagaagtaaagaaa
gaggctgatcctggagaaacaccatcagaggctccaagtgaagcgagaacgactccagca
gaaaatggggtgaatcacactacaaccctgacacccaagccaccctcccaggctctccac
agccagccagctccaggttctgtaaaggcacctgccaaaacagaagatcttattcagagt
gtcttaacagaagtggaagcacagaccatcgaagaactaaagcaacagaaatcgtttgtg
aaacttcaaaagaaacactacaaagaaatgaaagacctggttaagagacaccacaagaaa
accactgaccttatcaaagaacacactaccaagtataatgaaattcagaatgactacttg
agaaggagagccgctttggaaaagtccgccaaaaaggacagtaagaaaaaatcggaaccc
agcagccctgatcatggttcatcaacgattgagcaagacctcgctgctctggatgctgaa
atgacccaaaagttaatagacttgaaggacaaacaacagcagcagctgcttaatcttcgg
caagaacagtattatagtgaaaaataccagaagcgagaacatattaaactgcttattcaa
aagttgacggatgtcgcagaagagtgtcagaacaatcagttaaagaagctcaaagaaatc
tgtgagaaagaaaagaaagaattaaagaagaaaatggataaaaagaggcaggagaagata
acagaagctaaatccaaagacaaaagtcagatggaagaggagaagacagagatgatccgg
tcatatatccaggaagtggtgcagtatatcaagaggctagaagaagcgcaaagtaaacgg
caagaaaaactcgtagagaaacacaaggaaatacgtcagcagatcctggatgaaaagccc
aagctgcaggtggagctggagcaagaataccaagacaaattcaaaagactgcccctcgag
attttggaattcgtgcaggaagccatgaaaggaaagatcagtgaagacagcaatcacggt
tctgcccctctctccctgtcctcagaccctggaaaagtgaaccacaagactccctccagt
gaggagctgggaggagacatcccaggaaaagaatttgatactcctctgtga

KEGG   Homo sapiens (human): 5330Help
Entry
5330              CDS       T01001                                 

Gene name
PLCB2, PLC-beta-2
Definition
(RefSeq) phospholipase C beta 2
  KO
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Chemokine signaling pathway
Phosphatidylinositol signaling system
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Apelin signaling pathway
Gap junction
Platelet activation
NOD-like receptor signaling pathway
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Glucagon signaling pathway
Renin secretion
Aldosterone synthesis and secretion
Relaxin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Carbohydrate digestion and absorption
Alzheimer's disease
Huntington's disease
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Amoebiasis
Pathways in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5330 (PLCB2)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    5330 (PLCB2)
   04310 Wnt signaling pathway
    5330 (PLCB2)
   04371 Apelin signaling pathway
    5330 (PLCB2)
   04020 Calcium signaling pathway
    5330 (PLCB2)
   04070 Phosphatidylinositol signaling system
    5330 (PLCB2)
   04072 Phospholipase D signaling pathway
    5330 (PLCB2)
   04071 Sphingolipid signaling pathway
    5330 (PLCB2)
   04022 cGMP - PKG signaling pathway
    5330 (PLCB2)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    5330 (PLCB2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5330 (PLCB2)
   04621 NOD-like receptor signaling pathway
    5330 (PLCB2)
   04062 Chemokine signaling pathway
    5330 (PLCB2)
  Endocrine system
   04911 Insulin secretion
    5330 (PLCB2)
   04922 Glucagon signaling pathway
    5330 (PLCB2)
   04912 GnRH signaling pathway
    5330 (PLCB2)
   04915 Estrogen signaling pathway
    5330 (PLCB2)
   04921 Oxytocin signaling pathway
    5330 (PLCB2)
   04926 Relaxin signaling pathway
    5330 (PLCB2)
   04918 Thyroid hormone synthesis
    5330 (PLCB2)
   04919 Thyroid hormone signaling pathway
    5330 (PLCB2)
   04916 Melanogenesis
    5330 (PLCB2)
   04924 Renin secretion
    5330 (PLCB2)
   04925 Aldosterone synthesis and secretion
    5330 (PLCB2)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5330 (PLCB2)
   04270 Vascular smooth muscle contraction
    5330 (PLCB2)
  Digestive system
   04970 Salivary secretion
    5330 (PLCB2)
   04971 Gastric acid secretion
    5330 (PLCB2)
   04972 Pancreatic secretion
    5330 (PLCB2)
   04973 Carbohydrate digestion and absorption
    5330 (PLCB2)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    5330 (PLCB2)
  Nervous system
   04724 Glutamatergic synapse
    5330 (PLCB2)
   04725 Cholinergic synapse
    5330 (PLCB2)
   04728 Dopaminergic synapse
    5330 (PLCB2)
   04726 Serotonergic synapse
    5330 (PLCB2)
   04720 Long-term potentiation
    5330 (PLCB2)
   04730 Long-term depression
    5330 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    5330 (PLCB2)
  Sensory system
   04742 Taste transduction
    5330 (PLCB2)
   04750 Inflammatory mediator regulation of TRP channels
    5330 (PLCB2)
  Environmental adaptation
   04713 Circadian entrainment
    5330 (PLCB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5330 (PLCB2)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    5330 (PLCB2)
   05016 Huntington's disease
    5330 (PLCB2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    5330 (PLCB2)
  Infectious diseases
   05146 Amoebiasis
    5330 (PLCB2)
   05142 Chagas disease (American trypanosomiasis)
    5330 (PLCB2)
   05143 African trypanosomiasis
    5330 (PLCB2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     5330 (PLCB2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    5330 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    5330 (PLCB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q00722(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
15q15.1
AA seq 1185 aa AA seqDB search
MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKAWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKR
VEAALSACHLPKGKNDAINPEDFPEPVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LTKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGINAQRGQLSPEGMVWFLCGPEN
SVLAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPIILSFENHVDSPRQQAKM
AEYCRTIFGDMLLTEPLEKFPLKPGVPLPSPEDLRGKILIKNKKNQFSGPTSSSKDTGGE
AEGSSPPSAPAGEGTVWAGEEGTELEEEEVEEEEEEESGNLDEEEIKKMQSDEGTAGLEV
TAYEEMSSLVNYIQPTKFVSFEFSAQKNRSYVISSFTELKAYDLLSKASVQFVDYNKRQM
SRIYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMAVFEFNGQSGYLLKHEF
MRRPDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRT
KLSPSTNSINPVWKEEPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPINALNSGYHHL
CLHSESNMPLTMPALFIFLEMKDYIPGAWADLTVALANPIKFFSAHDTKSVKLKEAMGGL
PEKPFPLASPVASQVNGALAPTSNGSPAARAGAREEAMKEAAEPRTASLEELRELKGVVK
LQRRHEKELRELERRGARRWEELLQRGAAQLAELGPPGVGGVGACKLGPGKGSRKKRSLP
REESAGAAPGEGPEGVDGRVRELKDRLELELLRQGEEQYECVLKRKEQHVAEQISKMMEL
AREKQAAELKALKETSENDTKEMKKKLETKRLERIQGMTKVTTDKMAQERLKREINNSHI
QEVVQVIKQMTENLERHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAEVKE
SVRACLRTCFPSEAKDKPERACECPPELCEQDPLIAKADAQESRL
NT seq 3558 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgctcaaccctgtcctgctgccccccaaggtgaaggcctatctgagccaaggg
gagcgcttcatcaaatgggatgatgaaactacagttgcctctccagttatcctccgtgtg
gatcctaagggctactacttatactggacgtatcaaagtaaggagatggagtttctggat
atcaccagcatccgggatactcgctttgggaagtttgccaagatgcccaagagccagaag
ctccgggacgtcttcaacatggactttcctgataacagtttcctgctgaagacactcacg
gtggtgtccggcccggacatggtggacctcaccttccacaacttcgtctcctacaaggag
aacgtgggcaaggcctgggctgaggacgtactggccctagtcaaacatccgctgacggcc
aacgcctcccgcagcaccttcctggacaagatccttgtgaagctcaagatgcagctcaac
tctgaagggaagattccggtgaagaactttttccagatgtttcctgctgaccgcaagcgg
gtggaagctgctctcagtgcctgccacctccccaaaggcaaaaatgacgccatcaatcct
gaggacttcccagaacctgtctacaagagtttcctcatgagcctctgtcctcggccagaa
atagatgagatcttcacttcttaccatgctaaggccaaaccctacatgacgaaggagcac
ctgaccaaattcatcaaccagaaacagcgggactcccggcttaactccctgctgttcccg
ccagcacggcctgaccaggtgcagggcctcatcgacaagtatgagcccagtggcatcaat
gcacagaggggccagctgtcacctgaaggcatggtctggtttctctgtgggccagagaac
agcgtgctggcccaggacaagctgctgctccaccacgacatgacgcagccactcaatcat
tacttcatcaactcgtcccacaacacctacctgacagccggccagttctcaggcctctcc
tcggctgagatgtaccgccaggtgctgctctctggctgccgttgcgtggagctagactgc
tggaaggggaaaccccctgacgaggagcccattatcacccatggcttcaccatgaccaca
gacatcttcttcaaagaagcaattgaggctattgcagaaagcgcctttaagacctccccc
tatcccatcatcctgtcgtttgagaaccatgtggactcaccccgccagcaggctaagatg
gctgagtattgccggacgatctttggggatatgctgctcacagagcccctggaaaagttc
ccactaaaaccaggtgtccccctgcccagccctgaggatctcaggggcaagatcctcatc
aagaacaagaagaaccagttttctggccccacctcctccagtaaggatactggtggggag
gctgagggcagcagcccacccagtgcccctgcaggtgagggcacagtgtgggctggcgag
gaagggactgagctggaggaggaggaggtggaagaggaagaggaggaggagtcaggaaac
ctggatgaagaagagattaagaagatgcagtcggatgagggcacagcgggcctggaagtg
acggcttatgaggagatgtccagcctagtcaattacatccagcccaccaagttcgtctcc
tttgagttctctgcccaaaagaaccgaagttatgtcatctcgtccttcacagagctcaag
gcatatgacctgctctccaaggcctcggtgcagtttgtggactacaacaagcgccagatg
agccgcatttaccccaagggaacccgcatggactcctccaactacatgccccagatgttc
tggaatgctggatgccagatggttgccctcaacttccagacgatggacttgcccatgcag
cagaacatggcagtatttgagttcaacgggcagagcggctacctcctcaagcatgagttc
atgcgccggccggacaagcagttcaaccccttctcagtggaccgcatcgacgtggtggtg
gccaccaccctttccattacggtgatctctgggcagttcctgtcagaacgcagcgtgcgc
acctatgtagaagtggagctgtttggccttcctggggaccccaagaggcgctatcgaact
aagctgtcacccagtactaactccatcaatcctgtctggaaggaggagccctttgtcttt
gagaagatcttgatgcctgagctggcctccctcagagtggctgtgatggaggaaggcaac
aagtttcttggacaccgcatcatccccatcaatgccctaaattctgggtaccaccacctg
tgcctgcacagtgagagcaacatgcccctcaccatgcctgcgctcttcatcttcctggag
atgaaggactacatacctggtgcttgggcagatctcactgtggccctcgccaaccccatt
aagttcttcagtgcccatgacacgaagtctgtgaagctcaaggaggccatgggaggtctg
cctgagaagcccttcccactggcgagtccagttgccagccaggtcaatggggcgttggcc
ccaacgagcaatgggtcaccagcagccagggccggggccagggaagaggctatgaaagaa
gctgcggagccgcggaccgccagcctggaggagctccgggagctaaagggcgtggtgaag
ctgcagcggcggcacgagaaggagctgcgagagttggagcggcgcggagcgcggcgctgg
gaggagctgctgcagcggggcgcggcgcagctggcggagctcgggccaccgggcgtgggg
ggcgtcggggcctgcaagctcggtcccggcaagggctctcgcaagaagaggagcctgccc
cgcgaggagagcgccggagccgcgccgggcgagggccctgagggcgtggacgggcgcgtg
cgggagctgaaagacaggctggagctggagctgctgcggcagggcgaggagcagtacgag
tgcgttctgaagcgcaaggagcagcacgtggccgagcaaatctccaaaatgatggagctg
gccagagagaaacaggcggcagagctgaaggccctgaaggagacgtcggagaacgacacc
aaagagatgaagaaaaagctggagacaaagagactggagcggatccagggcatgaccaaa
gtcaccacagacaagatggcccaggagaggttgaagagagagattaacaactcccacatc
caggaagtagtgcaggtgatcaagcagatgacggagaacttggagaggcaccaggagaag
ctggaggagaagcaggcggcttgcctggaacagatacgggagatggaaaagcagttccag
aaggaggcgctggcagagtacgaggccaggatgaagggtctggaggcagaggtgaaggag
tcggtgagggcctgcctcaggacctgctttccctccgaggccaaggacaagcctgagagg
gcctgcgagtgccccccagagctgtgtgagcaggacccactcatagcaaaggcagatgcc
caggagagccgcctctga

KEGG   Homo sapiens (human): 5331Help
Entry
5331              CDS       T01001                                 

Gene name
PLCB3
Definition
(RefSeq) phospholipase C beta 3
  KO
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Chemokine signaling pathway
Phosphatidylinositol signaling system
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Apelin signaling pathway
Gap junction
Platelet activation
NOD-like receptor signaling pathway
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Glucagon signaling pathway
Renin secretion
Aldosterone synthesis and secretion
Relaxin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Alzheimer's disease
Huntington's disease
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Amoebiasis
Pathways in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5331 (PLCB3)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    5331 (PLCB3)
   04310 Wnt signaling pathway
    5331 (PLCB3)
   04371 Apelin signaling pathway
    5331 (PLCB3)
   04020 Calcium signaling pathway
    5331 (PLCB3)
   04070 Phosphatidylinositol signaling system
    5331 (PLCB3)
   04072 Phospholipase D signaling pathway
    5331 (PLCB3)
   04071 Sphingolipid signaling pathway
    5331 (PLCB3)
   04022 cGMP - PKG signaling pathway
    5331 (PLCB3)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    5331 (PLCB3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5331 (PLCB3)
   04621 NOD-like receptor signaling pathway
    5331 (PLCB3)
   04062 Chemokine signaling pathway
    5331 (PLCB3)
  Endocrine system
   04911 Insulin secretion
    5331 (PLCB3)
   04922 Glucagon signaling pathway
    5331 (PLCB3)
   04912 GnRH signaling pathway
    5331 (PLCB3)
   04915 Estrogen signaling pathway
    5331 (PLCB3)
   04921 Oxytocin signaling pathway
    5331 (PLCB3)
   04926 Relaxin signaling pathway
    5331 (PLCB3)
   04918 Thyroid hormone synthesis
    5331 (PLCB3)
   04919 Thyroid hormone signaling pathway
    5331 (PLCB3)
   04916 Melanogenesis
    5331 (PLCB3)
   04924 Renin secretion
    5331 (PLCB3)
   04925 Aldosterone synthesis and secretion
    5331 (PLCB3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5331 (PLCB3)
   04270 Vascular smooth muscle contraction
    5331 (PLCB3)
  Digestive system
   04970 Salivary secretion
    5331 (PLCB3)
   04971 Gastric acid secretion
    5331 (PLCB3)
   04972 Pancreatic secretion
    5331 (PLCB3)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    5331 (PLCB3)
  Nervous system
   04724 Glutamatergic synapse
    5331 (PLCB3)
   04725 Cholinergic synapse
    5331 (PLCB3)
   04728 Dopaminergic synapse
    5331 (PLCB3)
   04726 Serotonergic synapse
    5331 (PLCB3)
   04720 Long-term potentiation
    5331 (PLCB3)
   04730 Long-term depression
    5331 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    5331 (PLCB3)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5331 (PLCB3)
  Environmental adaptation
   04713 Circadian entrainment
    5331 (PLCB3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5331 (PLCB3)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    5331 (PLCB3)
   05016 Huntington's disease
    5331 (PLCB3)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    5331 (PLCB3)
  Infectious diseases
   05146 Amoebiasis
    5331 (PLCB3)
   05142 Chagas disease (American trypanosomiasis)
    5331 (PLCB3)
   05143 African trypanosomiasis
    5331 (PLCB3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     5331 (PLCB3)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    5331 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    5331 (PLCB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q01970(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.1
AA seq 1234 aa AA seqDB search
MAGAQPGVHALQLEPPTVVETLRRGSKFIKWDEETSSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVSGPDPVNTVFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLKFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSTDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIEPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRPSAGGPDS
AGRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPQKSLGD
EGLNRGPYVLGPADREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRARQLAALIGESEAQAGQETCQDTQSQQL
GSQPSSNPTPSPLDASPRRPPGPTTSPASTSLSSPGQRDDLIASILSEVAPTPLDELRGH
KALVKLRSRQERDLRELRKKHQRKAVTLTRRLLDGLAQAQAEGRCRLRPGALGGAADVED
TKEGEDEAKRYQEFQNRQVQSLLELREAQVDAEAQRRLEHLRQALQRLREVVLDANTTQF
KRLKEMNEREKKELQKILDRKRHNSISEAKMRDKHKKEAELTEINRRHITESVNSIRRLE
EAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLLGEMPEGLG
DGPLVACASNGHAPGSSGHLSGADSESQEENTQL
NT seq 3705 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgcccagcccggcgtccacgcgctgcagttggagccgcccaccgtggtggag
accctgcggcgcgggagtaagttcatcaaatgggacgaggagacctccagtcggaacctg
gtgaccctgcgtgtggaccccaatggcttcttcttgtactggacgggccccaacatggag
gtggacacactggacatcagttccatcagggacacacggacaggccggtacgcccgcctg
cccaaggaccccaagatccgggaagttctgggctttgggggtcccgatgcccggctggag
gagaagctgatgacggtggtgtctgggccagacccagtgaacacagtgttcttgaacttc
atggccgtgcaggatgacacagccaaggtctggtctgaggagctattcaagctggctatg
aacatcctggctcagaacgcctcccggaacaccttcctgcgcaaagcatacacgaagctg
aagctgcaggtgaaccaggatggtcggatccccgtcaagaacatcctgaagatgttctca
gcagacaagaagcgggtggagactgcgctggaatcctgtggcctcaaattcaaccggagt
gagtccatccggcctgatgagttttccttggaaatctttgagcggttcctgaacaagctg
tgtctgcggccggacattgacaagatcctgctggagataggcgccaagggcaagccatac
ctgacgctggagcagctcatggacttcatcaaccagaagcaacgcgacccgagactcaac
gaagtgctgtacccgcccctgcggccctcccaggcccggctgctcatcgaaaagtatgag
cccaaccagcagtttctggagcgagaccagatgtccatggagggctttagccgctacctg
ggaggcgaggagaatggcatcctgcccctggaagccctggatctgagcacggacatgacc
cagccactgagtgcctacttcatcaactcctcgcataacacctatctcactgcggggcag
ctggctgggacctcgtcggtggagatgtaccgccaggcactactatggggctgccgctgc
gtggagctggacgtgtggaagggacggccgcctgaggaggaacccttcattacccacggc
ttcaccatgaccacagaggtgcctctgcgcgacgtgctggaggccattgccgagactgcc
ttcaagacctcgccctaccccgtcatcctctccttcgagaaccatgtggactcggcaaag
caacaggcaaagatggctgagtactgccgctccatctttggagacgcgctactcatcgag
cctctggacaagtacccgctggccccaggcgttcccctgcccagcccccaggacctgatg
ggccgtatcctggtgaagaacaagaagcggcaccgacccagcgcaggtggcccagacagc
gccgggcgcaagcggcccctggagcagagcaattctgccctgagcgagagctccgcggcc
accgagccctcctccccgcagctggggtctcccagctctgacagctgcccaggcctgagc
aatggggaggaggtagggcttgagaagcccagcctggagcctcagaagtctctgggtgac
gagggcctgaaccgaggcccctatgttcttggacctgctgaccgtgaggatgaggaggaa
gatgaggaagaggaggaacagacagaccccaaaaagccaactacagatgagggcacagcc
agcagcgaggtgaatgccactgaggagatgtccacgcttgtcaactacatcgaacctgtc
aagttcaagtcctttgaggctgctcgaaagaggaacaaatgcttcgagatgtcgtccttt
gtggagaccaaggccatggagcaactgaccaagagccccatggagtttgtggaatacaac
aagcagcagctcagccgcatctaccccaagggcacccgcgtggactcctccaactacatg
ccccagctcttctggaacgtagggtgccagcttgttgcgctcaacttccagaccctcgat
gtggcgatgcagctcaacgcgggcgtttttgagtacaacgggcgcagcgggtacctgctc
aagccggagttcatgcggcggccggacaagtccttcgaccccttcactgaggtcatcgtg
gatggcatcgtggccaatgccttgcgggtcaaggtgatctcagggcagttcctgtccgac
aggaaggtgggcatctacgtggaggtggacatgtttggcctccctgttgatacgcggcgc
aagtaccgcacccggacctctcaggggaactcgttcaaccccgtgtgggacgaagagccc
ttcgacttccccaaggtggtgctgcccacgctggcttcacttcgcattgcagcctttgag
gaggggggtaaattcgtagggcaccggatcctgcctgtctctgccatccgctccggatac
cactacgtctgcctgcggaacgaggccaaccaaccgctgtgcctgccggccctgctcatc
tacaccgaagcctcggactacattcctgacgaccaccaggactatgcggaggccctgatc
aaccccattaagcacgtcagcctgatggaccagagggcccggcagctggccgccctcatt
ggggagagtgaggctcaggctggccaagagacgtgccaggacacccagtctcagcagctg
gggtctcagccgtcctcaaaccccacccccagcccactggatgcctccccccgccggccc
cctggccccaccacctcccctgccagcacctccctcagcagcccagggcagcgtgatgat
ctcatcgccagcatcctctcagaggtggcccccaccccgctggatgagctccgaggtcac
aaggctctggtcaagctccggagccggcaagagcgagacctgcgggagctgcgcaagaag
catcagcggaaggcagtcaccctcacccgccgcctgctggatggcctggctcaggcacag
gctgagggcaggtgccggctgcggccaggtgccctaggtggggccgctgatgtggaggac
acgaaggagggggaggacgaggcaaagcggtatcaggagttccagaacagacaggtgcag
agcctgctggagctgcgggaggcccaggtggacgcagaggcccagcggaggctggaacac
ctgagacaggctctgcagcggctcagggaggtcgtccttgatgcaaacacaactcagttc
aagaggctgaaagagatgaacgagagggagaagaaggagctgcagaagatcctggacaga
aagcgccataacagcatctcggaggccaagatgagggacaagcataagaaggaggcggaa
ctgacggagattaaccgtcggcacatcactgagtcagtcaactccatccgtcggctggag
gaggcccagaagcagcggcatgaccgtcttgtggctgggcagcagcaggtcctgcaacag
ctggcagaagaggagcccaagctgctggcccagctggcccaggagtgtcaggagcagcgg
gcgaggctcccccaggagatccgccggagcctgctgggcgagatgccggaggggctgggg
gacgggcctctggtggcctgtgccagcaacggtcacgcacccgggagcagcgggcacctg
tcgggcgctgactcggagagccaggaggagaacacgcagctctga

KEGG   Homo sapiens (human): 5332Help
Entry
5332              CDS       T01001                                 

Gene name
PLCB4, ARCND2, PI-PLC
Definition
(RefSeq) phospholipase C beta 4
  KO
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Chemokine signaling pathway
Phosphatidylinositol signaling system
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Apelin signaling pathway
Gap junction
Platelet activation
NOD-like receptor signaling pathway
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Glucagon signaling pathway
Renin secretion
Aldosterone synthesis and secretion
Relaxin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Alzheimer's disease
Huntington's disease
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Amoebiasis
Pathways in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Disease
H01884  
Auriculocondylar syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5332 (PLCB4)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    5332 (PLCB4)
   04310 Wnt signaling pathway
    5332 (PLCB4)
   04371 Apelin signaling pathway
    5332 (PLCB4)
   04020 Calcium signaling pathway
    5332 (PLCB4)
   04070 Phosphatidylinositol signaling system
    5332 (PLCB4)
   04072 Phospholipase D signaling pathway
    5332 (PLCB4)
   04071 Sphingolipid signaling pathway
    5332 (PLCB4)
   04022 cGMP - PKG signaling pathway
    5332 (PLCB4)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    5332 (PLCB4)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5332 (PLCB4)
   04621 NOD-like receptor signaling pathway
    5332 (PLCB4)
   04062 Chemokine signaling pathway
    5332 (PLCB4)
  Endocrine system
   04911 Insulin secretion
    5332 (PLCB4)
   04922 Glucagon signaling pathway
    5332 (PLCB4)
   04912 GnRH signaling pathway
    5332 (PLCB4)
   04915 Estrogen signaling pathway
    5332 (PLCB4)
   04921 Oxytocin signaling pathway
    5332 (PLCB4)
   04926 Relaxin signaling pathway
    5332 (PLCB4)
   04918 Thyroid hormone synthesis
    5332 (PLCB4)
   04919 Thyroid hormone signaling pathway
    5332 (PLCB4)
   04916 Melanogenesis
    5332 (PLCB4)
   04924 Renin secretion
    5332 (PLCB4)
   04925 Aldosterone synthesis and secretion
    5332 (PLCB4)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5332 (PLCB4)
   04270 Vascular smooth muscle contraction
    5332 (PLCB4)
  Digestive system
   04970 Salivary secretion
    5332 (PLCB4)
   04971 Gastric acid secretion
    5332 (PLCB4)
   04972 Pancreatic secretion
    5332 (PLCB4)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    5332 (PLCB4)
  Nervous system
   04724 Glutamatergic synapse
    5332 (PLCB4)
   04725 Cholinergic synapse
    5332 (PLCB4)
   04728 Dopaminergic synapse
    5332 (PLCB4)
   04726 Serotonergic synapse
    5332 (PLCB4)
   04720 Long-term potentiation
    5332 (PLCB4)
   04730 Long-term depression
    5332 (PLCB4)
   04723 Retrograde endocannabinoid signaling
    5332 (PLCB4)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5332 (PLCB4)
  Environmental adaptation
   04713 Circadian entrainment
    5332 (PLCB4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5332 (PLCB4)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    5332 (PLCB4)
   05016 Huntington's disease
    5332 (PLCB4)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    5332 (PLCB4)
  Infectious diseases
   05146 Amoebiasis
    5332 (PLCB4)
   05142 Chagas disease (American trypanosomiasis)
    5332 (PLCB4)
   05143 African trypanosomiasis
    5332 (PLCB4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     5332 (PLCB4)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    5332 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    5332 (PLCB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q15147(Tbio)
UniProt: 
Position
20p12.3-p12.2
AA seq 1175 aa AA seqDB search
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVL
ECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPE
VTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPTAFSYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRALPSPNDLKRKILIKNKRLKPEVEKKQLEALRSM
MEAGESASPANILEDDNEEEIESADQEEEAHPEFKFGNELSADDLGHKEAVANSVKKGLV
TVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVG
LGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQL
NQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGT
YVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNK
LIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKK
FLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQSSSELRPTTTAA
LASGVEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQ
VDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVAQH
TKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKLSHDRESKEMRAHQ
AKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQ
LEHLEFLEKQNEQAKEMQQMVKLEAEMDRRPATVV
NT seq 3528 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaccttatgaatttaactggcagaaggaagttccctcctttttgcaagaagga
gcagtttttgacagatacgaggaggaatcctttgtgtttgaacccaactgcctcttcaaa
gtggatgagtttggcttctttctgacatggagaagtgaaggcaaggaaggacaggtgcta
gaatgctccctcatcaacagtattcggtcgggagccataccaaaggatcccaaaatcttg
gctgctcttgaagctgttggaaaatcagaaaatgatctggaagggcggatagtttgtgtc
tgcagtggcacagatctagtgaacattagttttacctacatggtggctgaaaatccagaa
gtaactaagcaatgggtagaaggcctgagatcaatcatacacaacttcagggccaacaac
gtcagtccaatgacatgcctcaagaaacactggatgaaattggcatttatgaccaacaca
aatggtaaaattccagttaggagtattactagaacatttgcatcgggaaaaacagaaaag
gtgatctttcaagcactcaaggagttaggtcttcccagtggaaagaatgatgaaattgag
cccacagcattttcttatgaaaagttctatgaactgacacaaaagatttgtcctcggaca
gatatagaagatcttttcaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcaacgagatcctcgattgaatgaaattttattt
ccattttatgatgccaaaagggcaatgcagatcattgagatgtatgaacctgatgaagat
ttgaagaaaaaaggccttatatcaagtgatgggttttgcagatatctgatgtcagatgaa
aacgccccagtcttcctagatcgtttagaactttaccaagaaatggaccatcctctggct
cactacttcatcagttcttcccataacacttatctcactggcagacagttcggcgggaag
tcttcggtagaaatgtacagacaggttctcctggctggttgcagatgtgttgaacttgac
tgctgggatggaaaaggtgaagaccaagaaccaataataactcatggaaaagcaatgtgt
acagatatcctttttaaggatgtaattcaagccatcaaggaaactgcatttgtcacatca
gaatatcctgtaattctctcctttgaaaatcactgcagcaaatatcaacagtacaagatg
tccaaatattgcgaagatctatttggggatctcctgttgaaacaagcacttgaatcacat
ccacttgaaccaggcagggctttgccatcccccaatgacctcaaaagaaaaatactcata
aaaaacaagcggctgaaacctgaagttgaaaaaaaacagctggaagctttgagaagcatg
atggaagctggagaatctgcctccccagcaaacatcttagaggacgataatgaagaggag
atcgaaagtgctgaccaagaggaggaagctcaccccgaattcaaatttggaaatgaactt
tctgctgatgacttgggtcacaaggaagctgttgcaaatagcgtcaagaagggcctggtc
actgtagaagatgagcaggcgtggatggcatcttataaatatgtaggtgctaccactaat
atccatccatatttgtccacaatgatcaactacgcccagcctgtaaagtttcaaggtttc
catgtggcagaagaacgcaatattcattataacatgtcttcttttaatgaatcagtcggt
cttggctacttgaagacacatgcaattgaatttgtcaattataacaaacggcaaatgagt
cgcatttaccccaagggaggccgagtcgattccagtaattacatgcctcagattttctgg
aacgctggctgccagatggtttcactgaactatcaaaccccagatttagcgatgcaattg
aatcagggaaaatttgagtataatggatcgtgcgggtaccttctcaaaccagatttcatg
aggcggcctgatcgaacatttgaccccttctctgaaactcctgttgatggtgttattgca
gccacttgctcagtgcaggttatatcaggtcaattcttatcagataagaaaattggcacc
tacgtagaggtggatatgtatgggttgcccactgacaccatacgtaaggaattccgaact
cgcatggttatgaataatggactcaatccagtttacaatgaagagtcatttgtatttcgg
aaggtgatcctgccggacctggctgtcttgagaatagctgtgtatgatgataacaacaag
ctgattggccagaggatcctcccgcttgatggcctccaagccggatatcgacacatttcc
cttcgaaatgagggaaataaaccattatcactaccaacaattttctgcaatattgttctt
aaaacatatgtgcctgatggatttggagatatcgtggatgctttatcagatccaaagaaa
tttctctcaattacagaaaagagagcagaccaaatgagagctatgggcattgaaactagt
gacatagccgacgtgcccagtgacacttccaaaaatgacaagaaaggaaaggccaacacc
gccaaagcaaatgtgacccctcagagtagctctgagctcagaccaaccaccacggctgcc
ctggcctctggtgtggaagccaagaaaggtattgaacttatccctcaagtaaggatagaa
gacttaaagcagatgaaggcttacttgaagcatttaaagaaacagcagaaggagctaaat
tctttaaagaagaaacatgcaaaggaacacagtaccatgcagaagttacactgcacgcaa
gttgacaaaattgtggcacagtatgacaaagagaagtcgactcatgagaaaatcctagag
aaggcaatgaagaagaaggggggaagtaattgtctcgaaatgaaaaaagaaacagaaatc
aaaattcagacgctgacatcagatcacaaatctaaggtcaaagagattgtagcacagcac
acaaaggaatggtcagaaatgatcaatacccacagtgctgaggagcaagaaatccgagac
ctgcacctcagccagcagtgtgagctgctgaaaaagctactcatcaatgcccacgagcag
caaacccagcagctgaaactgtcccatgacagggaaagcaaggaaatgcgagcacaccag
gctaagatttctatggaaaatagcaaagccatcagccaagataaatctatcaagaataaa
gcagaacgggaaaggcgagtcagggagttaaacagcagcaacactaaaaagtttctggaa
gaaagaaagagacttgccatgaagcagtccaaagaaatggatcagttgaaaaaagtccag
cttgaacatctagaattcctagagaaacagaatgagcaggcgaaggagatgcagcagatg
gtgaaattggaagccgagatggaccgcagaccagcaacagtagtatga

DBGET integrated database retrieval system