KEGG   Homo sapiens (human): 23237Help
Entry
23237             CDS       T01001                                 

Gene name
ARC, Arg3.1
Definition
activity-regulated cytoskeleton-associated protein
Orthology
K15867  
activity-regulated cytoskeleton-associated protein
Organism
hsa  Homo sapiens (human)
Pathway
Amphetamine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Substance dependence
   05031 Amphetamine addiction
    23237 (ARC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
8q24.3
AA seq 396 aa AA seqDB search
MELDHRTSGGLHAYPGPRGGQVAKPNVILQIGKCRAEMLEHVRRTHRHLLAEVSKQVERE
LKGLHRSVGKLESNLDGYVPTSDSQRWKKSIKACLCRCQETIANLERWVKREMHVWREVF
YRLERWADRLESTGGKYPVGSESARHTVSVGVGGPESYCHEADGYDYTVSPYAITPPPAA
GELPGQEPAEAQQYQPWVPGEDGQPSPGVDTQIFEDPREFLSHLEEYLRQVGGSEEYWLS
QIQNHMNGPAKKWWEFKQGSVKNWVEFKKEFLQYSEGTLSREAIQRELDLPQKQGEPLDQ
FLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRFLRHPLPKTLEQLIQRGMEVQDDLE
QAAEPAGPHLPVEDEAETLTPAPNSESVASDRTQPE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggagctggaccaccggaccagcggcgggctccacgcctaccccgggccgcggggcggg
caggtggccaagcccaacgtgatcctgcagatcgggaagtgccgggccgagatgctggag
cacgtgcggcggacgcaccggcacctgctggccgaggtgtccaagcaggtggagcgcgag
ctgaaggggctgcaccggtcggtcgggaagctggagagcaacctggacggctacgtgccc
acgagcgactcgcagcgctggaagaagtccatcaaggcctgcctgtgccgctgccaggag
accatcgccaacctggagcgctgggtcaagcgcgagatgcacgtgtggcgcgaggtgttc
taccgcctggagcgctgggccgaccgcctggagtccacgggcggcaagtacccggtgggc
agcgagtcagcccgccacaccgtttccgtgggcgtggggggtcccgagagctactgccac
gaggcagacggctacgactacaccgtcagcccctacgccatcaccccgcccccagccgct
ggcgagctgcccgggcaggagcccgccgaggcccagcagtaccagccgtgggtccccggc
gaggacgggcagcccagccccggcgtggacacgcagatcttcgaggaccctcgagagttc
ctgagccacctagaggagtacttgcggcaggtgggcggctctgaggagtactggctgtcc
cagatccagaatcacatgaacgggccggccaagaagtggtgggagttcaagcagggctcc
gtgaagaactgggtggagttcaagaaggagttcctgcagtacagcgagggcacgctgtcc
cgagaggccatccagcgcgagctggacctgccgcagaagcagggcgagccgctggaccag
ttcctgtggcgcaagcgggacctgtaccagacgctctacgtggacgcggacgaggaggag
atcatccagtacgtggtgggcaccctgcagcccaagctcaagcgtttcctgcgccacccc
ctgcccaagaccctggagcagctcatccagaggggcatggaggtgcaggatgacctggag
caggcggccgagccggccggcccccacctcccggtggaggatgaggcggagaccctcacg
cccgcccccaacagcgagtccgtggccagtgaccggacccagcccgagtag

DBGET integrated database retrieval system